Identifiers and Description

Gene Model Identifier

Contig4092.0.g70

Standard Name

None

Aliases

Contig4092_0_g70

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam08662 ) Eukaryotic translation initiation factor eIF2A
  • ( pfam12657 ) Transcription factor IIIC subunit delta N-term
  • ( pfam12894 ) Anaphase-promoting complex subunit 4 WD40 domain
  • ( pfam08801 ) Nup133 N terminal like

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010051206.002770351825016e-173hypothetical protein
SGDYGL003C1.999745369828301e-106CDH1 SGDID:S000002971, Chr VII
from 494174-492474, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4092.0.g70(coding)
ATGTCTTCATCTTTAGTAATGCAATATTAGAACTACCTGTAGGGGTAGCAGTAGCACTCT
AAGACCTATGGTCAAACATCTTCACAGGGAGATAGATTTATTTCGCAAAGAAATTGTTCC
CAGGAGATGTACAATAATTACGAAACTAAGAGTGAAATTTTCTCGCAAAATTCTCAAATT
AATCTCCTTGACAAACTAGGGTCACACACCTCATAAATTGTGGAGGAAAACAATGAAAAC
TAAATGAATTAGATTAATAGCATGTAAGGTGATGAGAATCAGAGGATGTATACAACTTTA
CTATAGAACCAGGTTCTAGGGATACAAAATCCGCATTTAATTCAGGGTGGCTATCTCAAT
GATGAGTTTATGGATAGCGTCGGGAGTATTGAAAAATCTATTCCCTTATCCCTTGCACCA
CCATCATCCTACAACGTACTCAGATTCAATCAGAGATCAGCAGTGGAGAGGTAGCCTCTC
GAGCAGTTCAACCCATATCAAGTTGCACCTTTCGCCGGTTTCGAAGAGGATTAATTGCTC
ACTGCTCCATATAAGCAACAGAGAAAAATTCCTAAAGTTCCTTTTAAGGTGCTCGATGCT
CCTGCACTTCAGGATGATTTCTATCTCAATCTCGTTGATTGGTCGTCTAGCAATATTCTT
GCAGTGGGCTTAGGGTCATGTGTGTATCTCTGGTCAGCGTAAAGCAGCAAAGTTACTAAA
CTCTATGATTTAGGATAAAATGATTCGGTGACAAGCGTATAATGGTCGAATCGCGGAAAT
CTTCTTGCAGTCGGAACAAATTCAGGAAGTTTATAAGTATGGGACACCCAAAAAAGTAAG
ATGGTGAAATCTCTTACTGGTCATGAGGGGAGAATCGGAACTGTAGCTTGGAACAGCAGA
TTCCTGAGCTCAGGATCAAGAGATAAATGTATCTTGCACAGAGACTTAAGAACTAAGCAT
AACTTTGAGGCAAAACTTATGGGTCATAAGCAAGAAGTTTGCGGGCTAAAATGGAGTTAC
GATGAGCAACAACTAGCTTCGGGAGGAAATGACAATAAGCTATTAATATGGAGCTTACAC
AACAGCTCAAGCCCCTAAGCGAAATTCTCCAATCATATAGCTGCAGTAAAGGCTATCGCA
TGGTCTCCACATTAGCACGGCCTACTAGCTTCAGGTGGAGGAACAGCAGATCGTTGTATT
AGATTCTGGAACACTTTGACTTTATCACCTTTGAGTACTCTTGAAACTGGGAGTTAAGTA
TGTAACTTGCTATTCTCCAAAAATGTGAATGAATTAGTAAGTACTCATGGCTATTCTCAA
AACCAAATTATCGTGTGGAAATACCCTACAATGAAAAAACTCGCTACTTTAACTGGGCAC
ACATATAGAGTTCTATACCTAGCATGCAGTCCAGATGGGTAAACTCTTGTGACTGGCGCT
GGAGATGAGACTCTGCGTTTTTGGAACGTATTTCCACCAAAGAAAGAATCGAGATCACCT
GTCTCCAGTATTATGCCTTCAACTATGGATCTAAGATGA


>Contig4092.0.g70(protein)
MSSSLVMQYQNYLQGQQQHSKTYGQTSSQGDRFISQRNCSQEMYNNYETKSEIFSQNSQI
NLLDKLGSHTSQIVEENNENQMNQINSMQGDENQRMYTTLLQNQVLGIQNPHLIQGGYLN
DEFMDSVGSIEKSIPLSLAPPSSYNVLRFNQRSAVERQPLEQFNPYQVAPFAGFEEDQLL
TAPYKQQRKIPKVPFKVLDAPALQDDFYLNLVDWSSSNILAVGLGSCVYLWSAQSSKVTK
LYDLGQNDSVTSVQWSNRGNLLAVGTNSGSLQVWDTQKSKMVKSLTGHEGRIGTVAWNSR
FLSSGSRDKCILHRDLRTKHNFEAKLMGHKQEVCGLKWSYDEQQLASGGNDNKLLIWSLH
NSSSPQAKFSNHIAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTLSPLSTLETGSQV
CNLLFSKNVNELVSTHGYSQNQIIVWKYPTMKKLATLTGHTYRVLYLACSPDGQTLVTGA
GDETLRFWNVFPPKKESRSPVSSIMPSTMDLR