Identifiers and Description

Gene Model Identifier

Contig4065.0.1.g96

Standard Name

None

Aliases

Contig4065_0_1_g96

Description

Ribosomal protein L13e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005786401.9997255150861791e-53Ribosomal protein L13e contain
ing protein
SGDYDL082W1.9998323414791308e-36RPL13A SGDID:S000002240, Chr I
V from 308424-308427,3087...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4065.0.1.g96(coding)
ATGGTTAAGCACAATAATTAACTTCCAAACGTTCATCTCAGAAAGCACTGGTAGAGATTC
GTTAAGTCATGGTTCAACCAACCAGCCAGAAAGCAGAGAAGATCACAAGCCAGACAAGAA
AAGGCAGCTAGACTCTTCCCCAGACCTCTTGAGAGACTTAGACCCATCGTCCACAGTCTA
ACTAGAAAGTACAATTCCAAGTTAAGATACGGAAGAGGCTTCACTTTGCAAGAGTTGAAA
CAAGCCAAGGTTAGCCCAAGATTCGCCCAAACAGTTGGCATCTCTGTTGACCACCGCAGA
CAAAACACCTCAGAAGAAGCTCTTCAAATGAACGTGCAGAGAATTGAGAGTTACAAGAGC
AAATTAATTTTGTTCCCAAGACGTGCCGACAAGCCCAAGAAGGGAGACATCCACGACGCC
ACCGCAGATAAGCTCAAGTCAGCTGAATCAGCCAAGCAAAACCTCCACAAGCACGTTATC
GCAAAGCCCACTAAGAAGGTCAGAGAAGCTTTCCAGAAGATCACCTAGGAGCAAAAGGAT
CTCAGAGTCTTCAGAAAGATTCGCCAAGTCCAAGTTAACCAAAAGTACAGAGGACAGAGA
GAGAAGAGAGCTAGAGAGCTTGCCGAAAAGGAGGCCGAGGCCAAGAAATGA


>Contig4065.0.1.g96(protein)
MVKHNNQLPNVHLRKHWQRFVKSWFNQPARKQRRSQARQEKAARLFPRPLERLRPIVHSL
TRKYNSKLRYGRGFTLQELKQAKVSPRFAQTVGISVDHRRQNTSEEALQMNVQRIESYKS
KLILFPRRADKPKKGDIHDATADKLKSAESAKQNLHKHVIAKPTKKVREAFQKITQEQKD
LRVFRKIRQVQVNQKYRGQREKRARELAEKEAEAKK