Identifiers and Description

Gene Model Identifier

Contig4056.0.0.g86

Standard Name

None

Aliases

Contig4056_0_0_g86

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13639 ) Ring finger domain
  • ( pfam00533 ) BRCA1 C Terminus (BRCT) domain
  • ( pfam04564 ) U-box domain
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYCR066W0.000000019990673443141236RAD18 SGDID:S000000662, Chr II
I from 231500-232963, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4056.0.0.g86(coding)
ATGAAAGCTCACCCTCGCTCTAATATGACTTCAGGTCTAAACATGTTAGATGAGACAAAT
GACACCTCTACAAATAAGAAGCAATTGTCTTCAGATAAGGTGATGAGCACTGAAAAATCT
CACTTAAATGTATTTTCTCCCACAAATCATGGAAATACCATCACTAATGAGAACACAAAC
AATCGCAGAGAAAGCTTAATGAGCGATATATTGATGGAGAGGTCACCTGCTGTTTCTGTG
AGACCATCGATTCAGAGAAATATAAGCATTCCCTATGACACTTACTAGCGTATCTGTGAA
GAGTTGAGGTGCCCTATTTGTAAGGACATCTTTAAAGATCCAATCTTTTTACCTTGCAAT
CATGTGTTTTGCAAGGGTTGTCTGGCTTCACAAGTAACAAACCAAAAGACTTTTGAAAAA
GTTGCAAGATGTGCAGAATGTAACATAGAGTTCTCCCGTAGAAACAGAGAGACAAATCTG
AAGTTCAACAAGATCCTGGAGTGCTTCAAGGAAATCCGCACTAACAACAATCTTTTGACT
CAAATCCCAGAACATTTTGATGCCTATAATCCCTTCAAAGCTGCTGAGAAGCTTAGAAAT
GCAAAGATGAAGTTAGATGCCAATAAGCAAGGAGAGATGATTAAGATTTAAAATTCTTAG
TAAAATTAGCAGTAACAACCTTGGAAACCTGTAGGCAAAACAAACAATTCAAATCCTTTT
CTAAGTTCCAGTAACCCTCAAAATTTATTCAACAGAAAAATGAGTAATGTACAAAATGCA
GCTAACAATTTGAGCGCAAATCACTCAGAAGAGAGAAAAGAACTTAATACGCCAAATACA
AATAAGAAAATGAGTTTTCAAGTAATGGATTCCTCTAATAACTCAGCAAATCCAAGAAAT
GCCAATAATAAAAGATAGTCATAAAATTAAAGGAGTACAAGTGGGAGTACCAACACCAGA
TTTGGTAAGAAGCAACAATAACTGCAATCTACTTTGCCATTTTCTATCCAAAAATAGGGT
GATCACAGAATGAGTTCGGATAGTTTTGAGGAAGAATATGAGAAGGAAGAGTCTTAGGAT
CAAAGAAAAGTTGGCACCAGGAAGGGAAAAGGCAATACCAAGCAAAACAAAGTTTAATCA
AGAAGTGTGAGTGTAAAGACGAGAGCAGCCAGTTAAAGAAAGTAGAATTAAGGACAAGGA
AGGTAAAATAATCGAAATCACTAAAGATAAAACGAAGGGCTTGAAGATGTAGAAGAAGAA
GTCTCTGAAGTCAATCATGAAGATAGCGAGAGTCTTGCAGTTGGTCCATAAAAACGAGGA
AGAAAATCTACTAAGCAGCAACAACTTAAAAAGAAGTCAAAGAGTCTTGATACTATTGCA
CTATAAATAAGTAATTTGAGAAAAACTAGAGCCTAAAAATAGCAAGCAGTTTCTAAAGCT
CCTATTTAAAAACAAAAGAAAGCACCAGCTAACAAAACTCAAGCAAAGAATCCGACTAAC
TAGAATGTTTAGAGAAGGGCAAACAAAAAGAGAGGCAATAAGTTAAAACCAAAGACTTAA
GGCAGATTCTAGAAAGCCAATGGAAAGTTTATATAAGAGCTTGAGCCTCAAATTATTGAA
AAGCCAATTATTTGTGATAAAAGCATTCATAAGCCTATTGATATTTATCACTCAGCCATT
CCTTAAGAATTGAAGAAAACAATCAAGGCATTCTGCAAAAAATATGTCAAGTTTAGGTTT
GTTGAAAATGATGATGCTTTCTTGAAAATAATTCCTGCTTCAGAAGACTAATAAATTCAC
GAAGATGTGGATTAAAAAGAAAATTAGGTTTGTGCTAAATAAAACTTAGAGGAAGCTAAG
GGGAACGAAAGAAAATACTAAAAAGAGTAGCAAAGAATCCCACTATTGATTGTCCAATAA
ATTGAGTACCTGACTCTTACTGCTAAAGTAGTTCATGCCTTAGTTTAATAGATACCAATC
GTTGCATTTGAATGGATAGTAAAGATGAACTCTGCAAAGCAAATTACTGAGAAGGATCAC
CACTATACTAATTTCATGAGAAAGCATGTTGATGTGTCTACTTTATTCTCTGGACTCCAC
TTTGAGCTATTGCCTGATTTGAAGGCTGAGTAGTAAAAGAATCTTCGTTAGTACATCCCT
AGTTGCGGTGGTGTCCTCTATAAGAAATCCTTAATGCGAAACAACGCTTACAACTCTCAA
TCCTCCAATTCTAACAAATAAATTCCAAATTTTGGCATAAAAATGGTTAGAGTTGGTGTG
AAACACGAGAAGGGCACGGAGCAAGTGATAAAAGAGAAATTTGAAGGCATAAATAGTCAG
ACAGATGTGAATATTCATGTTGAAGATTTGCCCAAGCAAATTGCAGTCGACTACCACTGG
GTATTGTTTTCAATTATGCATGGCAAGCTGGTTGACTACTCCAATGATCTCAAACTTGGC
TTAAGTGATGAGGATGAGTTGTGA


>Contig4056.0.0.g86(protein)
MKAHPRSNMTSGLNMLDETNDTSTNKKQLSSDKVMSTEKSHLNVFSPTNHGNTITNENTN
NRRESLMSDILMERSPAVSVRPSIQRNISIPYDTYQRICEELRCPICKDIFKDPIFLPCN
HVFCKGCLASQVTNQKTFEKVARCAECNIEFSRRNRETNLKFNKILECFKEIRTNNNLLT
QIPEHFDAYNPFKAAEKLRNAKMKLDANKQGEMIKIQNSQQNQQQQPWKPVGKTNNSNPF
LSSSNPQNLFNRKMSNVQNAANNLSANHSEERKELNTPNTNKKMSFQVMDSSNNSANPRN
ANNKRQSQNQRSTSGSTNTRFGKKQQQLQSTLPFSIQKQGDHRMSSDSFEEEYEKEESQD
QRKVGTRKGKGNTKQNKVQSRSVSVKTRAASQRKQNQGQGRQNNRNHQRQNEGLEDVEEE
VSEVNHEDSESLAVGPQKRGRKSTKQQQLKKKSKSLDTIALQISNLRKTRAQKQQAVSKA
PIQKQKKAPANKTQAKNPTNQNVQRRANKKRGNKLKPKTQGRFQKANGKFIQELEPQIIE
KPIICDKSIHKPIDIYHSAIPQELKKTIKAFCKKYVKFRFVENDDAFLKIIPASEDQQIH
EDVDQKENQVCAKQNLEEAKGNERKYQKEQQRIPLLIVQQIEYLTLTAKVVHALVQQIPI
VAFEWIVKMNSAKQITEKDHHYTNFMRKHVDVSTLFSGLHFELLPDLKAEQQKNLRQYIP
SCGGVLYKKSLMRNNAYNSQSSNSNKQIPNFGIKMVRVGVKHEKGTEQVIKEKFEGINSQ
TDVNIHVEDLPKQIAVDYHWVLFSIMHGKLVDYSNDLKLGLSDEDEL