Identifiers and Description

Gene Model Identifier

Contig3977.0.g98

Standard Name

None

Aliases

Contig3977_0_g98

Description

ThiF family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005546109.0044753715726e-126ThiF family protein
SGDYDR390C9.997764199084386e-16UBA2 SGDID:S000002798, Chr IV
from 1256847-1254937, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3977.0.g98(coding)
ATGGTAGAATAGCAACCAGCTCAAGAAAAAAGAGTTATGTCCACTGAAGTCAGAGACGAT
AACCCATATTCTAGACTTATGGCTCTCAAACGTATGGGAGTTGTAGAAAATTATGAAGAG
ATTAGGAAATTCACAGTTTTAATTGTGGGAGTAGGTGGAATTGGATCAGTGGTAGCAGAG
ATGTTAACCAGATGCGGTATTGGTAAACTTATACTTTATGACTATGACAGAGTGGAACTA
GCAAACATGAACAGAATGTTTTACTTACCTCAGCACTAAGGTTTGGCCAAAGTTGAGGCA
GCTAAGAAAAGTCTACAAGATATTAACCCAGATGTAGAAATCGAAACACACAATTAGAAC
ATATGCACAATCGAAAACTATGAAAAGTTCAATTAAAGGATCTTGCACGGATCACTCTAA
GGGGAAAGAGTAGATTTAGTTTTATCTTGTGTTGATAACTATGCAGCCAGAATGACTATA
AACAGAGCTTGCAACACTCTTAATCAATTATGGTTCGAAAGCGGAGTCTCTGAAAATGCA
ATGAGCGGGCATATTTAGCAATTGGTTCCAGGTGAAATTGCATGCTTTGCATGTGCACCA
CCTCTCGTTGTTGCTAGTGAAGGAGATGAAAATGAAATTAAGAGAGAAGGAGTTTGCGCA
GCTTCACTTCCCACGACAATGGGAATTATTGCTGGATTCCTCAGTCAAACTGTACTGAAA
TTTTTGCTCAGATTTGGTGAAGTAAGCCCCTTCCTTGGCTATAACGCCTTTAATGACTTC
TTCCCAAAATACCCATTGACCCCTAACCCTGAATGTTCAGATAAGAAATGTCAAGAATTA
TAGAAATACTATGAAGCTCACCCAGAAGAAAAAAGATTGAAGCCTAAAGAAGAAAAGAAA
GATGAAATAGTGGCAAGCTCTTAAGAAAACGAATGGGGTATTACTTTAGAAGAAGAGGAC
GATGGACAAGTTTAGTAATAAGAATAGAAATTTGTAGAAGTTAAATAGAATTAATCGTTA
TCTGAGTTGATGAGCAGCATGAAAAAATTGCAGACTAAGTAGTGA


>Contig3977.0.g98(protein)
MVEQQPAQEKRVMSTEVRDDNPYSRLMALKRMGVVENYEEIRKFTVLIVGVGGIGSVVAE
MLTRCGIGKLILYDYDRVELANMNRMFYLPQHQGLAKVEAAKKSLQDINPDVEIETHNQN
ICTIENYEKFNQRILHGSLQGERVDLVLSCVDNYAARMTINRACNTLNQLWFESGVSENA
MSGHIQQLVPGEIACFACAPPLVVASEGDENEIKREGVCAASLPTTMGIIAGFLSQTVLK
FLLRFGEVSPFLGYNAFNDFFPKYPLTPNPECSDKKCQELQKYYEAHPEEKRLKPKEEKK
DEIVASSQENEWGITLEEEDDGQVQQQEQKFVEVKQNQSLSELMSSMKKLQTKQ