Identifiers and Description

Gene Model Identifier

Contig392.1.g73

Standard Name

None

Aliases

Contig392_1_g73

Description

Phosphoglycerate kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009294509.997093137033517e-262phosphoglycerate kinase family
protein
SGDYCR012W2.0007864815129413e-165PGK1 SGDID:S000000605, Chr III
from 137746-138996, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig392.1.g73(coding)
ATGCTATCAAGGAAACTTGCTATCGATAACATCCCACACCTCATCAAGGGCAAACGCGTT
CTTATGAGAGTAGACTTTAACGTACCCATTAAAGAGGGAAAGATAAAGGATCTTACTAGA
ATCACAGGTGCTCTCCCATCCATCAATTATTGCCTTGAAAATGGAGCAGAGTCAGTTGTT
TTAATGAGTCATTTGGGAAGACCAGATGGACAAAGAAATGAAAAATTCTCAATGAAGCCA
GTCGTCCCAGCTTTGGAAGATTTACTTAAGAGAAAAGTTCAGTTCCTAGATGACTGCGTT
GGTTCACAAGTTGAATCAGAGTGCAAGAGCGCTACTAAAGGAAAGGTTATCCTCTTAGAA
AATCTTAGATTCCACATGGCTGAAGAAGGAAAGGGAGTTGTGAATGGAGAGAAAGTTAAA
GCAAGCAAGGATGAAATAGCTGCATTCAGAAAATCACTTACAAACCTTGCCGAACTCTAT
GTGAATGATGCCTTTGGTACTGCTCATAGAGCTCATTCTTCTATGGTAGGAGTTAATGTT
GAGACTAGAGCCGCAGGTTTCTTGATGAAGAAGGAACTTTAATACTTCTCAAAGATTTTA
GAGACCCCAGAAAGACCCTTAACTGTTGTTATGGGAGGTGCTAAAGTAGCAGATAAGATC
CAACTTATCATGAAACTTCTTGAACTCGTTGATGAAATGATTATCGGAGGAGGTATGGCC
TTCACTTTTAATAAAGTTCTTGATAATGCTCAAATTGGAAAGTCATTGTTTGATGAAGAA
GGAGCAAAAATTATTCCAGATATTATGAAAAAAGCTTAAGAGAGAGGAGTCAAGATTCAC
TTACCAAAGGATATTGTTATCGCAGATAAGTTCGAAGAAACTGCAAACACTCAACTCATT
GACTTGAAATCACAAGGTATCCCTGACGGTTGGATGGGTCTTGATATTGGTCCAAAGACT
ATTTCGGAAAATAGTAAAGTCATTCAAAGAGCTAAGACTGTTTTCTGGAACGGACCACAA
GGAGTATTCGAAATGGCTCCATTCGCTAAGGGTTCATTGGCTATGCTTGACGATATTATC
AAAGTCACTGAGAATGGAGCAACCTCAGTTGCTGGAGGTGGTGATACTGTTTCTCTTCTT
GGAAAAGTTAAAGGAGCTGCCCAAAAGATTTCTCATGTCAGCACTGGAGGTGGTGCCTCT
CTCGAGTTGCTTGAAGGTAAATAATTACCAGGAGTCGTTGCTCTTTCAGATAGACAATGA


>Contig392.1.g73(protein)
MLSRKLAIDNIPHLIKGKRVLMRVDFNVPIKEGKIKDLTRITGALPSINYCLENGAESVV
LMSHLGRPDGQRNEKFSMKPVVPALEDLLKRKVQFLDDCVGSQVESECKSATKGKVILLE
NLRFHMAEEGKGVVNGEKVKASKDEIAAFRKSLTNLAELYVNDAFGTAHRAHSSMVGVNV
ETRAAGFLMKKELQYFSKILETPERPLTVVMGGAKVADKIQLIMKLLELVDEMIIGGGMA
FTFNKVLDNAQIGKSLFDEEGAKIIPDIMKKAQERGVKIHLPKDIVIADKFEETANTQLI
DLKSQGIPDGWMGLDIGPKTISENSKVIQRAKTVFWNGPQGVFEMAPFAKGSLAMLDDII
KVTENGATSVAGGGDTVSLLGKVKGAAQKISHVSTGGGASLELLEGKQLPGVVALSDRQ