Identifiers and Description

Gene Model Identifier

Contig3598.0.1.g92

Standard Name

None

Aliases

Contig3598_0_1_g92

Description

Glutathione S-transferase, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00043 ) Glutathione S-transferase, C-terminal domain
  • ( pfam13417 ) Glutathione S-transferase, N-terminal domain
  • ( pfam02798 ) Glutathione S-transferase, N-terminal domain
  • ( pfam13410 ) Glutathione S-transferase, C-terminal domain
  • ( pfam13409 ) Glutathione S-transferase, N-terminal domain
  • ( pfam13413 ) Helix-turn-helix domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005753903.00039543526891e-44maleylacetoacetate isomerase f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3598.0.1.g92(coding)
ATGAGTAGAGTGCCAACCTTAGTGATCGATGGCAAGTCCCTTGCTGAAAGTGTAGCAATC
ATCGAATACATTGAAGAGACAAGACCAGAGCTTAGATAATTACTTCCTAAAGACCCTTAT
CTTAGAGCCAAAGTCAGACAGTTAGCTGAGATCGTTAATTCAGGTATTCAACCATTATAA
AACTTAGAGGTCCTCAACAAGGTAGAAGAGGAACTTCACGGAGATAGAAAAGCCTGGGCT
CAACATTTTATCAAGAAGGGAATGACTGCTTTCGAGAGTATCGTTAAGGAGACAAGAGGG
AAGTATTGTGTTGGTGATGAAGTTACACTTGCTGATGTATTTATCATACCACAGTTCTTC
GCTTGCGAAAGATTTGAGGTTGACCTCAAATAATTCCCTAACCTTATGGAGATAAGATCA
TCTTTGGAATCATTACCTGAATTTATTGCTGCAGATCAAAAAAATCAACCAGATTACGTT
TGA


>Contig3598.0.1.g92(protein)
MSRVPTLVIDGKSLAESVAIIEYIEETRPELRQLLPKDPYLRAKVRQLAEIVNSGIQPLQ
NLEVLNKVEEELHGDRKAWAQHFIKKGMTAFESIVKETRGKYCVGDEVTLADVFIIPQFF
ACERFEVDLKQFPNLMEIRSSLESLPEFIAADQKNQPDYV