Identifiers and Description

Gene Model Identifier

Contig3514.0.g13

Standard Name

RFC2

Aliases

Contig3514_0_g13

Description

Replication factor C C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007807506.996820840887259e-117ATPase, AAA family protein
SGDYOL094C2.9990203769197855e-115RFC4 SGDID:S000005454, Chr XV
from 142555-141584, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3514.0.g13(coding)
ATGAACGATTAATTTGAGAGACCATATGTTGAAAAATACAGACCAGAGACTTTAGACGAT
GTAGTTGGCAATAAATTTGCAATTGATCAGTTGAAAGCCATCGTCAAGTTCGGAAACATG
CCAAATCTCATTCTTGTGGGTCCACCAGGCACTGGTAAGACTTCAAGTGTGATGTGTATG
GCTAGATAAATGCTGAAAGAATGTGTAAAAACTGGAACTTTAGAATTGAATGCTTCTGAC
GATAGAGGTATCGATGTAGTCAGAGATAAAATCAAGGGATTTGCACATCAAAAAGTCACT
GTACCTCCAGGAATGCACAAGTTAATCATTTTGGATGAAGGTGATGCTATGACTGAAAGC
GCTTAATAAGCATTGAGAATGATTATGACAGAGTATTCAAGCACTACTAGATTTGCTATT
GCATGCAATGACAGTGCAAAGATCATTGAACCAATTTAATCAAGATGTGCAATTGTCAGA
TTTACTAAGCTTAACGATGAGGAGATTGTCGAGAGATTGCAGATTGTCATGGATAGAGAA
CAGATTGAGTACACTCCTGATGGCATAGAAGCATTGGTCTTCACTGCTGATGGTGATATG
AGATATGCACTTAACAATCTTCAAGCAACTTTTGCTGGTTTCTCAGTTGTCAACAAAGAG
AATGTATTCAAGGTTTGTGATCAACCTCACCCTGACTTGATGGCTAATGTCTTAAGAGCC
TGTTTACATGCTAGATTCACTGAAGCCTGTGCTTTGATTGATACAGTTTTCAATGAAGGT
TACAACTTGATCGACATTATCAACACTCTCACAAAGATAATGTAAAATATGCAGGATATC
AGATCAGAAGAAATGAGACTTAATTACCTTAAGGAGGCATCGATTATCAAAATGAGAACA
TTAGAAGGCAACAACTCACAGCTCTAATTGCATGGCTTTCTTGCTAACTTATGCCAACTT
GCTATATAACCTAATAAGCTCAAGTGA


>Contig3514.0.g13(protein)
MNDQFERPYVEKYRPETLDDVVGNKFAIDQLKAIVKFGNMPNLILVGPPGTGKTSSVMCM
ARQMLKECVKTGTLELNASDDRGIDVVRDKIKGFAHQKVTVPPGMHKLIILDEGDAMTES
AQQALRMIMTEYSSTTRFAIACNDSAKIIEPIQSRCAIVRFTKLNDEEIVERLQIVMDRE
QIEYTPDGIEALVFTADGDMRYALNNLQATFAGFSVVNKENVFKVCDQPHPDLMANVLRA
CLHARFTEACALIDTVFNEGYNLIDIINTLTKIMQNMQDIRSEEMRLNYLKEASIIKMRT
LEGNNSQLQLHGFLANLCQLAIQPNKLK