Identifiers and Description

Gene Model Identifier

Contig330.1.g125

Standard Name

None

Aliases

Contig330_1_g125

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001943306.9972728945133496e-59EF hand family protein
SGDYOR257W3.999374135750469e-31CDC31 SGDID:S000005783, Chr XV
from 811008-811493, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig330.1.g125(coding)
ATGAACAGAGGACCCATCCAGTCTAAAGCTTACACAGGGCACATTAGAAATATTATTAAC
AAAAACAGACCATAAATAGATGAGGAATAACTATAGGAACTCAAGGAAGCCTTCCATTTG
TTTGATACTAATCATTCAGGAACTATTGATGCCAGAGAGTTCAAGGCTGCAATGAGAGCA
CTTGGTCATGATTTTAGAAAGTCTGATGTTGTTCAATGTTTCGCAGAAGTTGACAAGGAT
ATTTCTGGAGCTCTTAACTTTGATGACTTTATCAGAATAGTTTAGCCAAGATTGAGAGAT
AGAAACTCAAAGGAGGAAATATTTAAAATCTTCAAGCTCTTTGATGAGGATAATACAGGT
AGAATCTCATTCAAAAATTTGAAAAAGATCTCTGCAGAGATAGGCGAAAATTTAAATGAT
GACGAACTTCATGAAATGATCAATGAAGCTGATAGAACAGGCGATGGACTTATTACATTT
GAGGATTTCTATAAAGTAATGAAAAAGAAGTGTGACGATCCTCTTGGAGAATTTGACTCA
GACGAAGATGATGATTACTGA


>Contig330.1.g125(protein)
MNRGPIQSKAYTGHIRNIINKNRPQIDEEQLQELKEAFHLFDTNHSGTIDAREFKAAMRA
LGHDFRKSDVVQCFAEVDKDISGALNFDDFIRIVQPRLRDRNSKEEIFKIFKLFDEDNTG
RISFKNLKKISAEIGENLNDDELHEMINEADRTGDGLITFEDFYKVMKKKCDDPLGEFDS
DEDDDY