Identifiers and Description

Gene Model Identifier

Contig3298.0.g70

Standard Name

None

Aliases

Contig3298_0_g70

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam11793 ) FANCL C-terminal domain
  • ( pfam12606 ) Tumour necrosis factor receptor superfamily member 19
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam12906 ) RING-variant domain
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam13300 ) Domain of unknown function (DUF4078)
  • ( pfam07562 ) Nine Cysteines Domain of family 3 GPCR
  • ( pfam13832 ) PHD-zinc-finger like domain
  • ( pfam13771 ) PHD-like zinc-binding domain
  • ( pfam07699 ) GCC2 and GCC3
  • ( pfam13240 ) zinc-ribbon domain
  • ( pfam07282 ) Putative transposase DNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008267300.000000000029994712494008525zinc finger protein
SGDYDL008W0.000019995566179747357APC11 SGDID:S000002166, Chr IV
from 433497-433994, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3298.0.g70(coding)
ATGATTGTAAGTTGTGACGATGGTTATATGGGACTCATGCAATTAAGCAAAATAATATCT
GCAAATTAAAATGTAAATGCTGAGATAAGTTACAAGTATAGCAGGCAATTGACCAAGCTA
AGAACCTACGATAATGAAATAACCTTCGTGAATAACGACAACAAAAGATTCACAAGATAT
TTATACTCCAATGACACTGGAAAATATTCGCAAGCTGAATAAACTACACGTACATCGAAC
TCAAATGATATAGTTATAGATGGATATATGTAGGATAAACTCTTGATGCTTTAAGTAACC
GATTCTGGACCATAGGTTTTATCTATTTATCTCTTTGATCAAAGCAGTGTAAAAATGTAG
TCATCCATTCAAGAGAAAATCATAGCATTTGATTCAATTAAAATATCCAATATTCAACAC
ATTTATGCAATTTAGCAAAGAGAAAACATTAACTATTTGGTGAATAAGTAGTTAAATGCC
GATGATAGTTATAAGGATTATTTGCAATACTTAACCATAGATGGCTGTGCAACTAATATT
AGAGTAAGTTACACAATCATAGCAATAAGTTGCATGACTTTCAAGCAGAATTCAGGACAG
ATTTTAATCTATTAACGCTAATCTATGGAACTAATTACAAAATTGGAAGGGAGTTTGGGT
GAATACTTAGGTGCTGAATTATAAATTATTTCTTCTAACGACGGAGTGTAAAACTACATA
GTCTATACTTCTTTGAAAATTCCAACTAATTCTACATCACTACTCCTCCACTACATTGAG
GTGTTAGTGAATAAATACAAATCAGCGAAAGATTAGTATGTCTCATAGATATTAAACATA
AACTACCCCACGGATACTGTTAACACGGGAAGTATTAGAATAGCAGGAGGAACAGAGAAA
TTAATGATGATGACTTAGAAGTTTGATAAGTTTCAAGGGTATCACTTTTGTTAGTATAAT
TAATATCTTTCTAAAGACGATGGCCAGTAATGCTAGAAGTGTGGAGGCAATTAAATAAGT
TTAGGGCCATCATCTGATAATTGTGTGGATTGTAATTCAGGATTCTCAGGGTCTTCCTCA
GATAATTAAAAGTACAATTTCATTTGTGATATAATCAAGGAAGAGCTAGATATTATCATG
ATTATAGCTCTGGCTGTGCTGATATTCTCAGTAGTACTCTTTACTATATCTCTAGTAGTG
CTCTGTAAAGTAAAGGGTTACATGTGCTTTAAGAGGGATGAAGAGTAAAGACAATAAGAA
TTAGAAGAAAGATTAAAGAGGCGAATGCGCATTATAGAACTTAAGCTAACTACAGTTAGA
TATGATAAAATAAAGAATGAAGAGAGGTCTAAGAGTTGCAGTATATGTTTTGAAGAGTTC
CAGCCAGAGGAAGAAATTAGGCAGACTTAATGCAAGCACGTATTCCACAATAAGTGCATT
AATGAATGGATTAAAACTAAAATATCAGATCCTGACTGCCCATACTGTAGAACTAAATTT
ATACTGTGA


>Contig3298.0.g70(protein)
MIVSCDDGYMGLMQLSKIISANQNVNAEISYKYSRQLTKLRTYDNEITFVNNDNKRFTRY
LYSNDTGKYSQAEQTTRTSNSNDIVIDGYMQDKLLMLQVTDSGPQVLSIYLFDQSSVKMQ
SSIQEKIIAFDSIKISNIQHIYAIQQRENINYLVNKQLNADDSYKDYLQYLTIDGCATNI
RVSYTIIAISCMTFKQNSGQILIYQRQSMELITKLEGSLGEYLGAELQIISSNDGVQNYI
VYTSLKIPTNSTSLLLHYIEVLVNKYKSAKDQYVSQILNINYPTDTVNTGSIRIAGGTEK
LMMMTQKFDKFQGYHFCQYNQYLSKDDGQQCQKCGGNQISLGPSSDNCVDCNSGFSGSSS
DNQKYNFICDIIKEELDIIMIIALAVLIFSVVLFTISLVVLCKVKGYMCFKRDEEQRQQE
LEERLKRRMRIIELKLTTVRYDKIKNEERSKSCSICFEEFQPEEEIRQTQCKHVFHNKCI
NEWIKTKISDPDCPYCRTKFIL