Identifiers and Description

Gene Model Identifier

Contig3169.0.g50

Standard Name

None

Aliases

Contig3169_0_g50

Description

26S proteasome subunit RPN7

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001912402.9986702110910746e-96Probable 26S proteasome non-AT
Pase regulatory...
SGDYPR108W2.0004062814618821e-57RPN7 SGDID:S000006312, Chr XVI
from 742454-743743, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3169.0.g50(coding)
ATGGACTTGGTTTTCGGTTTAGACGCTTCAAAGACTAACAAGGGTCCCTCTAAAGAATGG
ACTGAGAGGGAAATAGAAGAGGAGCTTAAGAAACTCGATGCAAAGATTGAGGATGCAAAG
ACCAATCAGGGAGATGTTGAGGTTAGAGATGCCATTCTTGACAAAGCAATATTTCTGAAG
TAAGAAGCCCGTGACTACCCAGAGGCAGAGAAAGTATTCAGAGATGCCTACTCAAAGTCA
GGAGGAGCTTCAAAGAAGATGGAAATTTTGTTTGATATTCTTCTAATGAACATTGAGAAG
TTCGATATCGATGCTCTCAAGAAAGATGTCACTCTTTGCAAATAGCTTGTCGATGAAGGA
GCTGATTGGGATAAGAAAAATAAGCTAAAGATCTTCGAGGGAGTCTACTGCATGCTGATT
CGTGATTTGAAGAGAGCAGCCGAACTCTTCATGAGTTCAATCGCAACCTTCACTTGTGTA
GAACTTATGAGCTACAAGGATTTCGTCTTCTACACTGTAGTCACTGCCATGGTCACTCAA
GACAGAAAGACCATCAGAAAGGAAGTTGTTCATTCACCTGATATCCTTGCAGTGATCAGA
GATATTCCATTCTTGAGACAATATATGGAAAGCTTTTACAACTGTGAGTACAAGACTTTC
TTTGAAGCCTTTGTTGAGATTATCGATTTGATCAAAGCAGACAAGTATCTCCAGACTCAT
GCCAATTTCTTCATTAAGGAAATGCGCTTAGTAGCTTACAGACAATACTTAGAAAGCTTC
AAGAGTGTGACTATTGAAAATATGGGCAGAGCTTTCGGTGTCTCCTCTGACTTCATTGAT
AAAGAGCTCTCTAACTTCATCTACATTGGGAAGATAAACTGCAAAATTGACAAGGTTTCA
GGTGTCATTGAATCAAACAGACCAAATAGAAAGGCAGAGCTGTTCCAGAATAACATCAAG
CAAGGCGATGCACTCTTAAATAGAATTCAGAAACTGGCAAGAGCACTCGATATTTGA


>Contig3169.0.g50(protein)
MDLVFGLDASKTNKGPSKEWTEREIEEELKKLDAKIEDAKTNQGDVEVRDAILDKAIFLK
QEARDYPEAEKVFRDAYSKSGGASKKMEILFDILLMNIEKFDIDALKKDVTLCKQLVDEG
ADWDKKNKLKIFEGVYCMLIRDLKRAAELFMSSIATFTCVELMSYKDFVFYTVVTAMVTQ
DRKTIRKEVVHSPDILAVIRDIPFLRQYMESFYNCEYKTFFEAFVEIIDLIKADKYLQTH
ANFFIKEMRLVAYRQYLESFKSVTIENMGRAFGVSSDFIDKELSNFIYIGKINCKIDKVS
GVIESNRPNRKAELFQNNIKQGDALLNRIQKLARALDI