Identifiers and Description

Gene Model Identifier

Contig2997.0.g29

Standard Name

None

Aliases

Contig2997_0_g29

Description

Pyridine nucleotide-disulphide oxidoreductase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam07992 ) Pyridine nucleotide-disulphide oxidoreductase
  • ( pfam13454 ) FAD-NAD(P)-binding
  • ( pfam03807 ) NADP oxidoreductase coenzyme F420-dependent
  • ( pfam13450 ) NAD(P)-binding Rossmann-like domain
  • ( pfam13738 ) Pyridine nucleotide-disulphide oxidoreductase
  • ( pfam00070 ) Pyridine nucleotide-disulphide oxidoreductase
  • ( pfam01266 ) FAD dependent oxidoreductase
  • ( pfam01210 ) NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
  • ( pfam03486 ) HI0933-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_015132607.998157153133101e-120hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2997.0.g29(coding)
ATGATGCTTACTAAGACATTAACTAAGAAATTTGGATCTGGGTTAACAACCCAATAAATG
GCTGCTTTCTCAGTCATTCACACTAAGGTCGCTATCATTGGAGGAGGTGCAGCAGGTCAA
GCAGTGGCTTCACAATTAGCAAATACCAAAAGATTTGATAAGAAAGATATCACTATTTTT
GATCCAGCAACTACCCATTATTATCAACCAGCCTTCACTATGGTCGGAGGTGGAGTCTTA
GGAACTAATGAGCAAGTAAGAAAGAGAGCATCCACTTATATTCATAGACCTATGGATACT
TTGACATCCTCAAGTGTGACTCTTAGAAAAGAGGCTATATAAACTTTCGATACTGATAAT
AGTCAAATTGAAACAAGCACTGGCTCAAGATACTCCTATAATTTTTTGGTTGTATGTCCA
GGTGTCTCGCTAAGATGGGATTTGGTAGAAGGATCTCAGGAAGCACTTGATGATCCAAAT
TCCCCTGTGGGTTCAATTTATAGATATGATTATGCTTAAAAAGCTTCTACACTTCGTGAG
AATTTCTAAGGTGGTAAAGCCATTTTTATTAACCCTAAAATGCCAGTCAAATGCGGTGGA
GCTCCTCAGAAAATGATGTATCTCTCAGAAGAAACATTCAGAAAGAATGGTGTTAGAGAT
AAATCAGAGGTTCATTTTTATTCATCAGCAGGTAATATGTTCCCAAATTGCGCTAAATAC
TCTGACAAACTTACACAAATTAAAGACAAAAAGGGAATTTAGTCACACTTTAACAACACA
GTATTTAAGGTTGATAAGGATGCTCGCAAAGTTTACTTCAGAGACAACAAAACCCAGGAT
GTCGTTGTTTAAAACTACGATTTCTTGCATATTGTCCCTCCACAAACCCCACCTGATTTC
ATTCTGAAGAGTGGTCTTCCAGCTCCTAACGGTTTCGTTGATGTGGATGCACAAACTTTG
AGACATAACAAAGCTGAAAATATTTACTCTTTGGGAGATGTTGCCAACCTACCCACTGCT
AAGACAGCTGCTGGTGCATACTCCTAAGCTCCAGTTGTAGTCTAAAACATTCTTAGACAA
ATGGATAAGAAGTATTTGAATGGGCATTATGATGGCTATAACAGTTGCCCAGTGTTTGTT
GGAGACAAGAAACTTATGCTTATTGAGTTCAAGTACGAAAACCAACCAAGCGAAACATTC
TACGAATAGCAAACTGAACCAAACAAACTATTTTACTTTATGAAGAAGGAAATATTCCCA
AGAGTCTACTTTAACTTGGCTTCCAAGGGAATGTGGTACGGAAAAAGTCTTATCTTTAAG
CCCACATTTTACTGA


>Contig2997.0.g29(protein)
MMLTKTLTKKFGSGLTTQQMAAFSVIHTKVAIIGGGAAGQAVASQLANTKRFDKKDITIF
DPATTHYYQPAFTMVGGGVLGTNEQVRKRASTYIHRPMDTLTSSSVTLRKEAIQTFDTDN
SQIETSTGSRYSYNFLVVCPGVSLRWDLVEGSQEALDDPNSPVGSIYRYDYAQKASTLRE
NFQGGKAIFINPKMPVKCGGAPQKMMYLSEETFRKNGVRDKSEVHFYSSAGNMFPNCAKY
SDKLTQIKDKKGIQSHFNNTVFKVDKDARKVYFRDNKTQDVVVQNYDFLHIVPPQTPPDF
ILKSGLPAPNGFVDVDAQTLRHNKAENIYSLGDVANLPTAKTAAGAYSQAPVVVQNILRQ
MDKKYLNGHYDGYNSCPVFVGDKKLMLIEFKYENQPSETFYEQQTEPNKLFYFMKKEIFP
RVYFNLASKGMWYGKSLIFKPTFY