Identifiers and Description

Gene Model Identifier

Contig290.0.g67

Standard Name

None

Aliases

Contig290_0_g67

Description

ThiF family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001491909.997093137033517e-262ubiquitin-activating enzyme E1
family protein
SGDYKL210W2.998603118130212e-178UBA1 SGDID:S000001693, Chr XI
from 39163-42237, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig290.0.g67(coding)
ATGAATGTAACAAACTCTAGTACTTAGAGTTAAGATACGACAAATTCGACTATCGTGGCT
GATGAGGCTCCACAGGTTTCATCAATTCAAGTTAGTTCAAGTGTAGCTAAATTATCATCT
ATTGCTTATGATAATGTGAGTGGGCAAGTTTCAGGGATATTTGGAATTTAAGACCAAGTT
AGTAAAGAAGAGACTACCTCACACCCCCAATTGATATTCTTTGATATTAAGGGGTCTAAA
GTTTCTCAGTAGTCTGTGCAAAACATTCAAATTGATAAGATAAGAACGATTGAAGGTCAA
GAGACGCATAAAGGCGTGAATGATTAGACAACGATATCAGGCAAGCAATTAAAGAGTGAA
ACCAGAGCTTTTGATTCTTACAGCATCTTGAGATTTGTTAAGGGAAGCAAAAGATAGGGC
ATTGAGATATCTTCAAGTGGCTTGACTGTCAGAATTACAAAGACTTCTTCTAAGAAATAC
GAGAATCATGAAGAGCTAGTCCTCACAAATATGGCATTCAACTCTGGACTCCATTTTTGG
GAATTTATAGCTCCAATCAGTTGCAATAACATCTAAATGGGAGTATACAACCCAGTTACA
AAGAAAGAGCTCCTCAATTCATTCAAGACCTCAACTTAAAGAGTGATCACAGTGTGCTTA
GACTTTAACGATGAGTCACTTAAGTTCTGGCTTAATGATAGAAGATCCTAGAATAAGACT
CTTAAATTACCAAACACATTGGGAGAGAGTGGTCCATGGATTCCATGTGTCAAGATCTCA
GGGGATAAGAACAAAATTATATTGAATCCATTCGCCAAAGAGCCCTCAGATTTCTATGAG
AAAGATTTTGACAAGAAGTTCAGCCTCAAGAAGTTCATTATGCCTTAACTTCATAACATG
ATTTGCATTACCAAGCTCCCTTAGGTTGAAGAGTCAGCAGGTAAAATAGTTCAAAAGCTT
TCAGAGCATCTCAAATTCAACCAGCAGGAAATTTAAAAAGTGCTTATGCTATACGATATA
CAAGACTCACAGGGCGATGAAAATTCCAGATTTTGCTTCTTAAAGTTTCATCATCATGAC
TATATGGCTGAATTTATTAGAAAGAGCAATAATCTTAAGGTTTACCAATAAGATACCATA
GCATCATGGGTACTTAATGGAAATTCAGAAAGTTTAGAGATTGAACTTCAAAAACCTTCA
AAATTGATAATTTAACACTTAAACATCCCGGAAAGCTCTTAAGATGAATTAAAGCAAAGC
TTTGACAGAATTTATTAGACTTTGACTTCATTCGAAAATTAAGGTGAATCTAGTAATTAA
CCCTCTTAATTTAATAACTTACAATTGACACAGTAGTAGTTCACTGATAAACTTATCATG
GTACAAAATAATCTGTTTGTTAAGACAGTCACAAGGGATGACTAAACTTAGAACTTCGAA
ATAGATTAATCTTGCATGAAAGAAAGTTTGTAAAACATCGACTCGTTGGTTGTACTTAAA
ATTAGAAAAGCTGCAACCAGTAATTTCTTCTTTGGAATAAACTGGGGACAGATCTTGAAA
GATTAGAATTCCTTGGTTTTCGGTCTAGTCTAAGATTTCCTCTCTTAAGCCCAAGAATCT
ATGACTTAAATAGGCGATTGTCTTAGTTTCGAAGTGAATTTAGTTACAGCTAAATTTACG
ATAGAACTTGCAATTCAGCACATGAAATCTCAACTGGATAGAATGAAGCGTTAATACTAA
AACAATCAAACTATTATTCCCACAGATTCACTCATTAATCATACTAAGCCTGAGGTACTA
TTTGAAATGCTAAAGAGTGAGCCTTACTACAGAGACCCTAATCTTTCTATCGATGAATTG
TATGCTGTTTTACACCTCCTCTATGATACTCATGAGCAAATATGGGCACAGACTAAGAAT
ATTTCATGTCCAGCTGATGTAAAATATTTAATGTAGACAGTGTCAAGACCCTTCTCTGCA
TTAAACAGACTTGGAAGTTTTGTGAATTGGGGTATCTCAAATGCAGACTCTTAACTTCTA
GCTGACTCTGGATTAGTATTTAAAGAAAATCATACTTTAGTATAAATTGAGAACCAACAA
ATAGAGTTACATGACTTGGCATAGAGATAACTATTCAATTAAGGAGATTTACAAGCTCTG
TTCGGTATTGGAAATCGAATTTTAAAGGGAGAAATTTGTGAAAATATCTCACTATCAAAG
TCCCTGAATTATTTACCTGCCTAAAAGATGTCTACTTAGTCACTGATCAATGATATTATC
GCAAGCTAAAACAATGTATTCTCTCTTGTTGCAAATGATAATGGGACAGTTAACATTTGT
TCTTCGACTATAGACACCTAAGTCTTAAAGTATGTAAGTTTCTTCGGAGGAGTGGACCCC
AACAGAGCCAAGAAATTGCAATCCTTCCACAAGAAAATTGAGGAGAGAATCAAGGCGTTG
AAGGACTACAACAAACAGAGCATCAAGAAGCTGGTCCCACTCTCAATTCTCAAAGGCCAC
AAGCTACCTCCACAGGATGCCACTAAGTTTAAAGACAAATAAGCTGCTCTTTAAAGTGCA
CTTGAGAAAAATCATAAGAAAAAGGCAAAGAAAGCTAAAAAACCAACTAAAGTCAATCAG
AAAAATATAGTAGCAGACGAAGTCATTCTTTTAGAGGATGAAAATGAAGATGTGTCAACA
CTTTAACCTGAATCTAAGAAATCAATTGATGAAACTTAACTCTTAAAGAGTTTAGAATCA
TTTAAGCTCAAAGATGTTAAGATATCTGGATATTTCCTTTTGACCAAACCTAACTATCAA
AAAGTCATGGACCCTATAGTTGTGGGATGTATCTTCTTGAACACTGAGAGTAATAAGTTC
TACATTAAGGCAATCTAAATCGCTTTCGATTTGGCGTACCTACATTGCTTCATCTATGTT
GATATGACATCTGGCTTACTCTACAACAAACTAACTGGAAAGCAAATTGAAGATTGCTCT
GACCTTAAAGTGGTCTACGAAGACATCTTAAATCAAGATCTCACAATAATTGATTTGTAC
TCCCTTTTCATAAGAAGCCAAATTATTAAGAAAGATTATGTGAAGAAGTATCACAAACAA
TTTGTCTTCGTAGAGAGTTGCTATGCAGCAATTGAAATAGAAAATTGCAAAGAAGTTATA
GATCACACAAGAAATTCTTACTCTATTGAGAACCAAGAAAAAGTTCATTTACTTATCAAG
AATCAAGAAAATAAAACATAACTTGTTCAATTCTACTTAAAGCAACAGGAACTAGACTCT
CAAAATATGACTTATAACTTATAGCTCTTCAGGGGGAAAGAGATGGAAGTTGATAATTAT
CCATAAAGAGTATTCTAATACGACAATAACATCATAGTTTTGAACAAATCTTCTTTCTAA
ATCCTGAATTAAGATACATTTAAGGTAGAACTAGAAGAGAAACTTTGTTCTGAAGTATAA
GATTATTCCAAGGCTGATATTCAAAACACTACTGATCCAAATTCATAATACACTTTGAAA
AATTGCAAGAAGTTCAGTTCAAAAGAAATCATACCGAAACAACAATGGAAATTATTCACT
CACTAGGAAACTGAGAATTCTATTTTTAGCTATTCATTGATGCTGGAGGATTATTAAAAT
TAGGAAGAGAAGGCTGTCAAATTAGCAGAGAGTTCAGATAAGACAGTTGATATTGATATC
TCAACTTGTGAAGCTAGTGACATTTTACAAATTAGCAGTTTGTTAAAAGCTTAATACGAT
GGGGTCATTGGTCACAAAAACGAATACTCCTTACAAACCTCATCAATTAGAGACCTTCAC
AATAATTTGTAAGTTAAGCATAGTTGGCACATTACAAAACCATTGCTTGATGGATTAAAG
TTTGATATCTCATTCCCTAAAAATGGGCATAGCAAAAATCATTTGAAGGAGGTTGAAATC
GAAATAAGCATGAAAAAGAAGGATGACCAGTAGATAAGACTAAGGCTTTTACAAAAAGCA
AGTTTAAATGATAGTCCCTAGCTTGATTAAACAGTCAAAAAGCTACCTTTAATTGTGGAA
TTTAACAATGGCTCTCAAATTAACGATGCTCTTCAGGCATGCCATATGACTAACCCTGAT
TCCGTTGTATTCTGTACAAACTACCCTAAACCAGAGTTTATATTTAAACATATTCATAAT
CACAGCTTCAGACCTACTTAATTTGTTATTAAAAGTAAAGAAAATAGAGAATGGACTGGA
GTTCCAATAGGTTCTGGTTTAATATTTGCTTCAAATAACTTGGAAGATCTATTTAATACG
AAACAGTTCTCTAAGTTTACAAAACAAGACTATTAGAAATGGAGATAGACAAGGGATAGG
GTTTCAGCATTACCGCTACTTTCAAATGAGCCAATTGCTTTCTTTGAAATGGGTGAATAA
AATGAAATTACAGTTGATGTAGAGATATAATAAAGCTTTAAATACGTTAAGATGATCCCT
GTTAGCTTTAGAGAAAGACCAATCAATTATACAAGCAAACCATTCAATTAAAACTAGCTT
GAAATTTAATTCTTTGGAATCAACGGCATAGATTTAGGTCATCTTAATGACTAGGAGTCA
ACTGGTGTGGAATCCATATCAATGTAACTTGATCAGGAAGATTTGAGCATACCTCTCAAA
GGAAAGCTCAATGATTACGTTCTAGGAGAGATCGGAAGCTTTAGCAATTTGACTTTAAAA
CATATTAAGAATCCAAAAGCTAACAATTAAGAACTTTCATTAGCTTCTATTATGAACAAA
AACTTAAAGAATGTGATATACGTAACCAAACACAAAATAAAAATAAGTGAAGAGTTCAGT
GATAAAGTTTAAAATCTGTCATTATAAATTGATCAGCTCAATGATCCAAGATGGGAGCTC
AGTGAAGTCTCAATGATGGTGAGCACTTATGACGACACATCTGCTACTTTTAAATCTTAG
ATACTTTAACAGAATAAACCCAAATTAAGACAGCAACTTTTAGATTCATAGAAGCATCCT
GAACTGCTTTTGCAGCTTTTGAAGATTTCTTAAGGTTAAGACTAAAGTCAATTAGATAAA
AAAGAGGCAGCAATATTATGTCTAATGAACCATCTAAAATAAAACTCTGATAAATCACAA
ATGAAAATTTTCTAAGACAGGATACAAGTGGACTAGTACTTAAATTATGATTTTATCGAT
CAACCAAAGCAACTACAATACGCATCTGTTGAGTTCCTTAAGTACTTAGGATTCTTAAAT
TCTTAAAACTCTGAGTTTATTACTAAATTTGTGATTCAACAACTTGACAAAATGTTTTAG
TATGCAAGACCTATTGAGCAAATAGAATAAGTACTTAGCTTATACTAATATGCTGTTCAA
AATGCAAAAACAGACGACAATAAGATCTCACAAAAAATTATTGAGGATTTCTACAAGAGA
ATAGTGCTATAAGAGCTGCCTAAATACTAAACTGAGGAGTACATAACTTTAAGATCAAAG
CTTAATATCAACTCTTTCCCATTTGATAAGGTTTCAATTCAAGAGAAGATTCCAAATTAC
GAACTTTCCAATAGAAATCAAACAGTTGATCATAGCATTTAAGGACTTTGCTGTAATATG
CACGTCACTAAGTACAACAGTGTTAATTGTTACAATGTAGATTTTACCAATTAAGTATAA
GTGAATAACCTTGCACTATCTTTTGAATCTGAATAAAAGGGGTTGTACAAGATTGGAGTT
AGAGTTATTGTTCCAAATCTCTAGGGCAAAGAGCAAATCATTTATGAAAGGTTCTACGAT
GAACTGTATTTCTAGTAACTTTGTGAAAAAGCAGAGAATGCTAAGGTCATAGAATATTTC
CATAATAAGTCAGATGCATCTCAATCTCAAAATGAAGACAATATATTAAACAGGGAAGAT
TTAGGCCTGAACACCATCTACCTTGACTTAAACAGCATTAAAACAAGATATATGAAAATT
CAAGTTGAATTCTTGGATACATATAGAACAATTCATAAAGTGGTGCCTATGACTTAAATT
TTTGTAAGACCCGAATTCTTTGGTAGAACAATTGCTCAACATTTGAATGGCTCTTAAGAA
TAAGAAGCAATTAACAAGTTATTCAAAATTCCAGAGATTGAAGAAGCTAGTTTGGTAGCC
ACCCTAAAATTCAAGAATGCTGAATACCTAGTTCATCTTATCTAAAACGATTAGCTTAGC
ATCTAACATAAATCATGCCTGATCAAAGTTCAATATCATGATAGAATTTCCTAAGATTCT
TCAGCTAAAAATGATGAAACCTAGCATGTTGAATAGACTGAGGAATAACTAAATGAGAGA
TTAAAGAAAATTGAAGCTCTATAAGTGGAGTTTAGATAAACAATTCTATCAAAGAATCTT
AAGAACATTTCAAAGAAAAAGATTCGAGCACAAAATTATGAAATTGTTAATATGATGAGA
CATTTTAGTTAATTCAAGTAAGATATTGGATTGAGATACTTACTCAAATTAGCAGAACTA
CTTGCAAATTATTCTCTTAAAATAAACTCAAAAGATGGTGTTAATTTTGGAGAAAATCTC
AACATCTCTGATGTTTATCTAAATCTATTTAAGAGATTCTCAGTCTTTGATATAAAGAGC
CAATACCCAAATATATAGAAATTACTAGAGAATATTTTCGAAAAAGTATCTAACAAACCA
GATTTTATATGCCAATTGTTTTCTGAATACCTTCTTAATTAAAACATTAATTACAATCAG
AGAAATGTAATTGCTTTTATCAAAGGAATGAAAAATATCGACTTAAATGATCTTCTACTA
GGTTTTGCGAAAGTATTTAAACTTGAGATTGATGATCAAGTGCTTTTGAATTCTTAAAAG
GCAACTATTAAAGATATTGACCAAGTTATCACAAGAATTAGCAGCTTACAGCACTCTTAA
AAACAATAAATTTCTACTTAGGCTATTATGGGATTCTTGTCAATTGTTGATGATTTGAAT
TTAGATGAAAAAATACTCCCTAATGAAAGGATAAGGTACGCCTATCAAGTCATGATTAAA
TACTTGGAGTTACCAGGAGTTAAGATCTCAGAAATTATTGCTAGAAGTTAAATTGATTTG
ATCTTCATGAAAATCTTGATTTTAAAAAATAATGATAAGGAAGTATAAAAGCTTCACAGA
AAACTAATTTCTCATTTAGGAATGCACGATACAAACTAGCATCTTGTGGATAGCGTTTCA
ACAGTGCTAAAATGGTATGAGTAGAATGAAAATCCTGTTCTTAAAAATTTCTATTCTCAA
TATGGTAATGAAAGTGAGTCGATGTACTACAGACACTTAGCTATGATTTTCAAACAATAT
GGTATCCTTTAAAAATCTATTCAGTTAAGCGGAAAACCTCTATAGGATGGTTAAGCAGGG
TAATAATTAAGTTCAATAACTTCAAATCTTTTGAAAGTTCTAATCAGCAACTAAAACAGT
CCTAATTACGAAGAAAACTTTTATTTCATATGGAGTTAGATCTTCAAACAAGCATTGAAA
AGTTCACATAAGATCTAAGGTCTCAACTAATCTATTGATAAGATGATGTCTGAGTTCTTT
AAACTGTAACCAATTCATATGGAATAACTCTATCCTAAGTTTGTAAAATCTACTGAGAAA
TTTGTTAAGCAATCGAATGACAGCATCTCAAGCCTTATTCCAATTATACAATACATCTTA
AAAAATGGATTTAGCGAGACAAGTTAAAATGGTTCACAAAAAAATCTTATATAAAATGCA
GCTTTTAACTTTGCCGACAGTTTGATAAGCATTATGATAAGTTCTTCCCCATAAAAATAA
AATACCAGTACAAACATCAGTGTAAAACTAGACAAGGAAACATCAAAGCAATTACTTTCT
GTGGTTTCTTGGTACCTAAATACTTATGTAAACGATGGTTATTACTTTGGAATTAATGGT
GCTAATCAAGGAACTATCATGAAACTCAGAATTGCTGTTGGACTGAGCAAATTGTTATCT
CTTCCTAATTCAAATGGAGAAGATGCATTCACAATTTACATTTAGCAAGATGACGAAGAT
TTAGAATAATTAATAGGTAGTCTAGTAAAATGGTCGTTTAATAATTTCTCAAATTAGAAG
ACCAAGTCAACTCCCGCTGGGCAGCTGATCTACTCCTTGAGTTAGTTAGTAGATTAAATG
CTCAGTAAAATCGGAAGGTATGAGAGCGCAGTAAACAAATGTCTTCCACTTTTAATGAAA
AACGTGCTCAGAATTGATGTTAAGCTAAGGGATCTCATTGCAAGTGAACAAATCAATCAA
AATAGATCAGTGTAAATACAAAAGAATGTGAATGAGCTTTTCCTGCAATACTTTAAGTCC
TGGATCCAGAGTGACGAAGTCGCCAAGCGGTTCCTCACTGAACTCAATGGCTTTGATTTC
CTACTCGACAGATTATTTTCAAATGAATCAGTTTAGGTTTCTGAGTCAAGCGAATCAAAT
TTGAATTTAATTGAGTAGATTGGGTTAAATAAAGAAGCAAATGAAGAGGGTGCGAATTCC
AGTGATGATGAAGAGGATGAAGAAAACTAATTAATGAAACTTATCTTAGAAAAACTTAAA
ATCAAAGATTAAACCAAAGGAAAACCAAAGCAGCAACAGTCCAAATCCATTGAAGACTCG
AGCAAGAAGCTCAAGAAACTGCCAACTATGGTGAAACAAGATGCAATTGTCAGCTCAGAT
TCCCCATCGAACAAAGCTGATTAAGCCATTACAAAAATTGAGCAGAAGCTAAATGTTGAC
GATTGGGGTAAAAACATAAAACTTATCCAAACTAGTGATTCGAAGCCTGTGCCTGTTCAA
CACGACCCAACTGTTTGGATTAAGTATAAATCTGGTTTAAAATAGAGAGTGCACAATGCA
TTACTTTCCGATGAATCTCAAGAATATGAATATTCAATGGTATTTGATCTTGGAGAGGTC
ATTCAGATAACTGAGATTCAGATGGGAGTTGTGTTTAGTTGGACTACATATGACTAAGAC
TAAAATTATGAACCATTAACAATCTTGTTGGAAGGAGGTATGAGCCAAAATAACTACGAG
TTCAAATCTTTAATGAGCTCAATTAAGGATTATGGATTTGAGTCTAATCAAGTGAGACCA
TATGGTTCCATTTTTTACCCAGTTGGGAATACAGATCAAAGTCAAACACTTGAAGATTAG
ATCGCTAACTTTGGGAAAAGAGAGGCTAGGTACTTAAAGATTAGATTTAGGAGAGTCATT
TAAACAAACCTTGATCAATCGTCCTTCATGAATCAAGTAGCTAAGGCAAAATCGATTGGA
ATTTCCTTCCTATCAGTCATGGGAACCCAACCTATTAAATCCTAACTAGTATTCTAACAT
CTCATTGAAATTCAAAAAGAAAACTCGCTCGAGGTCCTCTCCAAATTCTTCTCAGGTGAA
TTTACCTAAGCATTTGAGTTAATATCTGAGCAACCTTAGATTATCTTGAAAATTCAAAAT
GCTTTTGACAAGTTAGCAGTTTTACTCGATACAAAAGCCGAGCTTATTAAACCAATTTTC
ATAGCTATTTGTTCTAAAAATGAATAGTTAGGAGACTGGATTATGATTAACAGGCTTTTG
AAACTCTAAACAGATGCTATTAAGAAAGAACAGATCAAGTTCCTTGGAGAAATAATTAGC
TCTAATAAGAAGACTCAGTATGACAAGCTGATGAAGCTTAAGGACTTTATCTTTGACAGT
GTTAAAATTATATTGAGCATTGAATAAGTAGCCGAAGAAAAGTTGGATAAAATCAAGCTA
CTTAAGAGATTTATGAAGCTTTTTATTCAAAAACTTAGAGAATACTCTAACTACATTAGT
TCAAAGAGTGATAGCAAAACATTAACCTTGAACTTTTAAGAATAGAATATACTAGAAATA
ATTTCATTACTCTAATTCACTGATGAGAAAACTCTTTCGTTGCAAAATGCTATTATTACC
TTTGCACTTCAATTCATATCTCCACCTAATAATTTCGTTAACGACACAATCAGCAGAGAA
GATTTTGTAAGAAACTTATTGAAAGATTATTCTCCATCTAAGCTACTTATCGCATCCATT
ATTTCAGCTTCTAACACTGATTGCATGAAAATTTTACTTTAATCAGATGTTTTAAAGGAA
AAAATATTGAATGCATTAAGTGATCAAAAGATTGAGATGTAATTAGCATAAAACACTGCT
CAAATAATCTTAAATTGTACCTAAAATTCATTGTTCTTAGATACTATCAATAAAAGTGAA
ATTATTGATACAATTTATAATTTCATGAAGATTTAAGCAAATCATGATTCTACTGAGAAA
ACAGACTAGAAATTACTAAATAAGAACTAGTTAAATGATCAAACTTTGAACTTATTAGTA
GATACCTTGAAGCAGCTGTTTATAATGGACACCGATGTTTAGATTAAATACAGTTAAATT
CTAAAAGAAGACATGAAACTTGCTTCATAAATTGGTGATGTTGAATTCATTAGCAAAGTT
ATTGTGCCTATATTGCATAGTGAAAAATTAGAGAACATATCGATAAGTGTTAGAGATCCA
GCTACATCCAGAGTCAAATCATTCTTTGAGGGTGAAAAGATTTAAGCTAAGCAAGATACT
TTCTTCTTAAAATCTTCAATCCTAAATTCCAAACAGAAGAAAACACTTGATAAAGCGTTT
AGAGAGATCACTTAAGACAAAGTCGAGACTGCCAAGCTGGTCAAGAGCAAGTGGGAGTTG
ATCTACGAAGACTCTAATGTTCAGACAAAGAGCTAGCCAGAGTTCTTGAAGTTTGTGAAG
GCCGTATCCAACAAGTCGAATGTCTTTATACTTTTGAAAGCTAAAATCTTAGAGTAAGAG
GTAGTTTTTGGAGGGTACACTTGTCAGCCATTCCCTAACTTAGACGGCTAACTGACTTAG
GAATTCGACTATCAAATACCTTTCAGCGAAGCAAACTTTGTATTCTAATACAATACTGAT
AAGGAGTTACATTACACTATGACTCACAACAAACCATTTGGCTATATCTACACTGATTAT
GAAAGCAGTGGCGCACTCTCAATATCTGGGGACTTCTTCTTGATATCCTGGAGTCAAGAA
TTCTCAAACACTTGTGGTAACATCTATGATATGAAATGTATTGAGGATCCAAGCGTAATA
ACAATGTACAATAACATGAACATCATAGACATTGAAGTCTTCCACTGTGATTTGAATCAG
AAGGCACCTCCTTCAGGAGGGGTCACGCAGTTGAAGGAATTGAAGAAGCACAAATTCTAC
TAACCTCTCTCCCCCTTCAACTACCAGAGTGAGAACTTGGTGTTCAAAGTAAGTGAAGAC
ATGTCCTTAGAACAGATAAGTCTTGAGATACTTGGAAAGAAATCTCAATTCATTAAACCT
AGATCACCTGATGATGAAGTTGAAGAAACACAATTCTATGATAGATCATCTAAATTAAAG
GATGCAATTGAAAGAGACTAACTGGCTTGCGTTCATAATCTGCTTATCTAATAGAGTGAT
AAAAATGAGGACGAAGATAAGAAACAAGTACAGACTGAATCATAATTGGCTTATACACCA
AATAAGCCCATGCTGCAACTTTTCATTTAGAATGGCGGTATAATAGATTTACTCTAAGCT
GCAAAAGCCGCTGTGAGCTAATACGAGATTGAAGAGGTCAAGAATTTATGGGAATTGTGG
ATTCTAGAAATAGAGTCATTCAATAGCTTCCCTAATTTCTTCCAGCTATTCACAAAAGAC
CCCAGCAAGGAACAAGTCATTTACCAGCTGCTCTCAGGAGAATGCGATATTAAGAAGTAA
ACAAATCCAAATCCTAATGATCTCAAAAAGAAGATCAAGGACCAAGAAGAATTGCATTTG
GAGATGGTGACCCACACTTACAGAATACTCAGTCAGGTGTTCGAGACTCAAGAAAGCTCA
GAGTTGAGGGACAAATGTCTCAAGAATGACACCTTCCTCAGATTCATAGAAAGAATTGGG
CAACTCACCAGTGAAAAGAAAAGGATAAAAGCATAGAAAACTGAATAGATAATTGAATCT
CCCTCTAAGATAGTTGACGACTAAGATAAATAAATGAAGAAGAATACTTTCATAGAAGAT
AAGAACAAAGTGAAAAAAGGAGTAGGATACACGACTGGAGTTGATACTGCCTGGAATATA
AATGAATATCTAAAGTCAAAGGAATCTAAAAACCAATAGATCGCCAACATTATGAACATC
TTAACTAGTATAATTAAGTCCCAAGACTGGCAAGCTCCTTAAGAAGTAAAAGACATGATC
CTTGAATCTGCTCTACTTCCTGCATTAGAGGCTGGCTTCAGATCTGGGTCGTTGTTGGAG
ATGGCTAAGGATTATGAACTGAACATATCATATCTTGAGTTTGTCAAGGAACTGTCAAAT
CATCAGCAATTACTAGACTTGCTCCTGGATATTGGGGAAGACTATGAGCCTAGGCAGAAA
GAGTCCATTTATCAATTGTTAAAGAACATTGGAGGACTTAGCACTATCTTCTTGAGTTGC
CTGAATACAGAATCAGCTGATAAGAGCAACGAAAGTGAAGATTCCAAAAAGCCTAAGATC
CTGGCTGAGAGAATCATCACAACCATGGAGTTGGTGGAACAGAAACTCAAAGCAAACTAG
AGCTTAATCAACAAGTAATCTTTAGATGAAATTCTTGAAATGCCCTTATCAGAAGCATAT
CACAAATTGCTCTCTAATTTAAGATTTGAGTATATGAATGTCAAGAATAGTGCAGGAATA
TATGCTCACTACTATGTACATGATATCCCCAAAGGCGCAAATCCTCCTGTTTCAAAACTA
GTAAGATTAGCCTAGGAAATCGCAGACTTAAGTAACTCCTTACCTTGTGATTGGACGAAT
GCAATCTTCTGCAGAGTCGATAAGGAAAGAGTGGATGTAATGAAGTGTTTAATTATGGGA
GCTTCAGGTACCCCTTACGCTCATGGTGCATTTATTTATGATCTATTCTTTGAAAATACC
TATCCCAATGGTCCTCCAAAATGCACACTAGTTACAACCGGCGGTGGTACTGTAAGATTC
AATCCAAATCTCTATACAAACGGCAAAGTATGTCTATCACTCCTTGGTACTTGGAGAGGC
TCCTCTACTGAGAACTGGGATCCAAAACTTTCAACAATACTTTAAGTTTTACTGTCCATT
CAAGCAATCATTATGTCTAATGAGGTCTACTTTAATGAGCCAGGTTATGAACATGAGCAA
GGTACTCCTGAAGGTGAGTAAAAGAACGAGGGATATAGTAACATAGTTAGATATTGCAAT
GTGAAATTTGCCATGATTGATGCTATCAAGAATCCACCAGCTGGCTTTGAAAAGGTCATC
AAGAGAAGTTTCTATTTGAAAAAGAACGAAATCTTGAGAGAAGTGAAAGAATGGGTCGAT
AGAGCTAAAGTTACAGATGCTACTTACCAAGGATTGGTTTATGATCATAACTATCACTGG
GCTCCTCAGATAAGTCCAGAAGGTAAATATGCTCAATTAATGGAAGAAGCCTATAAAGAA
CTGAAGGAAACTCTTGAGTCTTTAACTTCTCCATTTGAAGATGAAAGCGGCAAGCAGATA
CAACGTAAATTCAGCAGTAGAGAGGATGATCCAGAGTAATCTGCTTAAGGTGGCAAAAAT
ATGAAGTTAGATGATATAGACGTCAGCTATGATCCAACAAGTAAGGAGCAAATTGAATAG
TCAATAGACATTAACGATGAAAAAGTTAAAGACAGATGGAGTAGATATATTGGAGCAATG
GGAATTGAAGCAGTTGCAAAATAAGCAGAATCTAGAATCCTTCTCCAGGGTCTCGGACCT
CTCGGTATAGAAATAGCTAAGAATATCGTTCTTGCTGGCTGCAAAGAGCTCATACTAACC
GATAGAACAAATGTCAGAGCAGCAGACTAATCAGGCTAATTTTTCATAGACAACAATGAT
TTGCAAAAACTTAAATTTAGAGATTAAAGTTCAGTTGCTAAGCTTTAACAACTAAATTAC
TATGTCAAAGTGTCTGTTATGGATAAGAGCAAGTCAGTTGTAGATTTCATTAAAGAAACT
AAAGATCTGAAAGTCGTAGTGCTTACTGAGCTTTATGAATCCTCCTTCGTTAATGAGGTA
AACAGGATTTGCAGAGAAAAGGGCATTTAGTTTATATATGCATGTCAAAATGGAGTTTTC
TCGAAGGTATTTACTGACTTTGGTAAAGAATTCATTGTCCTTGACAAAGACGGTGAGGAA
CTTCAGGAAGTGCTCATTAAGGACATCAGCTATGAAGAGAAATCCAACTCAAGCATTGTA
ACCCTATTAGAAGGATACAAGCACAGGTATCAAGATGGTGATATAGTTACTCTAAAAGAA
ATTTAAGGCATGTAAAAGAAGTCAGATATGAGTGATTCACTTAACAATTCACAGTCACGC
ATTACAGTTATAAACCCAACTTCCTTCAAACTCAATGATGTTGACATCAGAGAGTATTCG
AGCTATGAGGGTTCTGGGGTTGCCAAGCAAATTAAGGTACCAGTGACTATTAACTTCAAA
ACTTAAAAAGAGATTGAATCACTTGAGTCTCCAGCTCTAGATGAGAACTTGGCTATTTAC
GACTTCACCAAAATGGAGAACCAGCTCATCCTCCATGAAATTTACAAAGTATATGAGAAT
GTAAAGAGAAATTTGGCGAATGCTGGCTTAATAGAACAAATACTTGACTTATTCAAATAT
TTATATAAGGAAGAAGATTCAGATGAAAAGAAGAAGAAAATCAAAGAGATGCTTGAAATA
TTCTTGCTCACACAATCGTACTAATTACCACCTATTTGTGCTTTCATTGGAGGTGTAGTC
TCTTAAGAAATTGTCAAAGGTATTACTCAAAAGTACATGCCAATTAACTAATTATTCTAT
TTCGATTGCATGGAGCTATTTCCAATTGAAAAACTACAAGAGTTGATTGAAGAGCAATCA
TAATGTTTGTTTAAGGAAAGTGGAGACAGATATGACGGTTTGAATCTAATTTTAGGCAAA
GACCTCGTCAATAAGATGTTCAACTGCAAACTGTTCATGATTGGAGCAGGAGCCATTGGG
TGCGAGCTACTCAAGAACTACGCCATGCTGGGATTAGGTACTGGCACTGAGGGATAAATC
ATACTTACGGATCCTGATGTTATTGAGGTTAGTAACCTTAATAGATAGTTCTTATTCAGA
GAGAAGCATTTACGTAAACCTAAATCATCGACAGCAGCAGCCGCAGCCATTCAAATGAAC
CCAAATCTAAAAAATCACGTGATAGCCAGATTAGATAAGATTCATGATGGTACCTCCCAT
ATCTACAATGAAAGCTTCTTTAAAGAGCAGTCAATAGTAACCAATGCTCTTGATAACGTA
GCCGCCAGATTATACATAGACGGGAAATGCGTGGCTGCTAGGACTACACTTATTGATAGT
GGTACTTTAGGTCCCAAGGGTCACGTGCAAATAGTACTGCCAGAGTATAAGACAGAATCT
TATGCTAGTTAGAATGACCCAGAAGACAACACCGAGATACCTCATTGCACACTAAAAATG
TTCCCAGAGGAAATTCTTCATTGTATTGAGTGGGCCAAAGACATATTTGGAAAACTGTAC
ACTTTATAACCACAGGTTGTTAATAAGTATTTGGAATAAAAGGACCCTATTAATTTCGCA
GATTAATAAGAACTCGCAAATATTAAGAAAGTTATAAACACTCTTGATAAAAAGCCACCT
AATTTCCTTGAATGTGTTAGACTTGCCAGAAAGAGATTCTAAAAACATTTCGTAAATGAC
ATTAAGCAATTACTACATGTTTATCCACTAGATAAAGTTACTAAGGATGGTAGACCATTC
TGGTCATTGCCAAAGAGACCTCCTCATCCAGTTGAATTCGATAAAGATAACTAAACGCAT
GTAGATTTCGTGGCAGCCTGTACACTTCTCTATGCAACAATTTATGGCAGTGAAATTCCT
GACTCTTACGTAAATCCTAGATCTTAAGAAGTCAAGCAAGCCATCGCTTAGATTGCTGCT
ATCTGTGAACAACCAGAATTCATACCAAACGATTAGAAAGCAACAGCCATACAATCTCAA
GTTGAAAAGGATCCTTCAAAAGAAAATTCTGAAATGGAGAAATAAAATGATAGTTAGTAG
ATTGACACTAGCACTACTCATTAGCAAGAAGATCAAATTCAAGAAATCAAACTTAAGTAT
GAGAATGTACTCAATGGCTTAAAAGAAGCCCAGGCAGAGTACGGTTCTACAAAACCCTAT
AGTATGTAGGTGCAAGAATTTGAGAAGGATAACGATTCTAATTATCACATCGATTTCATA
TACGCCATGGCAAACATCAGAGCACAGAACTACAATTTATAAGGTATGGATTGGATCGAT
GTAAAAATCAAAGCTGGCAGAATTATACCTGCACTTGCTACTACCACAGCTGCGATCGCT
GCTTTGTAAACTCTAGAGGTGCTGAAGTATCTGAAGGGATGCAAATTAGATGATCATAAG
AACTCATTTATGAATCTAGCTGTACCTTCTTTAATGATGAGTGAACCGGGTGCTGCTCTT
AAAACTAAATTGAAGGAAGGACTTGAAGTGACTCTCTGGGACAGATGGGAATACGATGCT
AGTCAGGACCCACTGAATGTCACTCTCTTAAGCATACTTAGCACTACCGAATCTAAGTAT
AACTTGAAGAGCCGAGATGTTTTCTTAGGATCATTCCCACTATTCCTTCATGCTTTGGAG
GGCAGAGATGAGGGCATGAAGATTAAGAATCTATCCGGTGTTCCTCTAATCGAGAAGTTA
CCTTAAAACCAAGGACTTTCCAAGTTAGACATTGAAGTTCCTGACTTCGTGGACTTGACT
GTGACATTTGTGGATGAAGGTAAATTTGATGAAAATGGACAAGAGAAAAATCTTGAAGGT
GTCCCTCAATTAAGAGTCATATTCAAGAAGCTATGA


>Contig290.0.g67(protein)
MNVTNSSTQSQDTTNSTIVADEAPQVSSIQVSSSVAKLSSIAYDNVSGQVSGIFGIQDQV
SKEETTSHPQLIFFDIKGSKVSQQSVQNIQIDKIRTIEGQETHKGVNDQTTISGKQLKSE
TRAFDSYSILRFVKGSKRQGIEISSSGLTVRITKTSSKKYENHEELVLTNMAFNSGLHFW
EFIAPISCNNIQMGVYNPVTKKELLNSFKTSTQRVITVCLDFNDESLKFWLNDRRSQNKT
LKLPNTLGESGPWIPCVKISGDKNKIILNPFAKEPSDFYEKDFDKKFSLKKFIMPQLHNM
ICITKLPQVEESAGKIVQKLSEHLKFNQQEIQKVLMLYDIQDSQGDENSRFCFLKFHHHD
YMAEFIRKSNNLKVYQQDTIASWVLNGNSESLEIELQKPSKLIIQHLNIPESSQDELKQS
FDRIYQTLTSFENQGESSNQPSQFNNLQLTQQQFTDKLIMVQNNLFVKTVTRDDQTQNFE
IDQSCMKESLQNIDSLVVLKIRKAATSNFFFGINWGQILKDQNSLVFGLVQDFLSQAQES
MTQIGDCLSFEVNLVTAKFTIELAIQHMKSQLDRMKRQYQNNQTIIPTDSLINHTKPEVL
FEMLKSEPYYRDPNLSIDELYAVLHLLYDTHEQIWAQTKNISCPADVKYLMQTVSRPFSA
LNRLGSFVNWGISNADSQLLADSGLVFKENHTLVQIENQQIELHDLAQRQLFNQGDLQAL
FGIGNRILKGEICENISLSKSLNYLPAQKMSTQSLINDIIASQNNVFSLVANDNGTVNIC
SSTIDTQVLKYVSFFGGVDPNRAKKLQSFHKKIEERIKALKDYNKQSIKKLVPLSILKGH
KLPPQDATKFKDKQAALQSALEKNHKKKAKKAKKPTKVNQKNIVADEVILLEDENEDVST
LQPESKKSIDETQLLKSLESFKLKDVKISGYFLLTKPNYQKVMDPIVVGCIFLNTESNKF
YIKAIQIAFDLAYLHCFIYVDMTSGLLYNKLTGKQIEDCSDLKVVYEDILNQDLTIIDLY
SLFIRSQIIKKDYVKKYHKQFVFVESCYAAIEIENCKEVIDHTRNSYSIENQEKVHLLIK
NQENKTQLVQFYLKQQELDSQNMTYNLQLFRGKEMEVDNYPQRVFQYDNNIIVLNKSSFQ
ILNQDTFKVELEEKLCSEVQDYSKADIQNTTDPNSQYTLKNCKKFSSKEIIPKQQWKLFT
HQETENSIFSYSLMLEDYQNQEEKAVKLAESSDKTVDIDISTCEASDILQISSLLKAQYD
GVIGHKNEYSLQTSSIRDLHNNLQVKHSWHITKPLLDGLKFDISFPKNGHSKNHLKEVEI
EISMKKKDDQQIRLRLLQKASLNDSPQLDQTVKKLPLIVEFNNGSQINDALQACHMTNPD
SVVFCTNYPKPEFIFKHIHNHSFRPTQFVIKSKENREWTGVPIGSGLIFASNNLEDLFNT
KQFSKFTKQDYQKWRQTRDRVSALPLLSNEPIAFFEMGEQNEITVDVEIQQSFKYVKMIP
VSFRERPINYTSKPFNQNQLEIQFFGINGIDLGHLNDQESTGVESISMQLDQEDLSIPLK
GKLNDYVLGEIGSFSNLTLKHIKNPKANNQELSLASIMNKNLKNVIYVTKHKIKISEEFS
DKVQNLSLQIDQLNDPRWELSEVSMMVSTYDDTSATFKSQILQQNKPKLRQQLLDSQKHP
ELLLQLLKISQGQDQSQLDKKEAAILCLMNHLKQNSDKSQMKIFQDRIQVDQYLNYDFID
QPKQLQYASVEFLKYLGFLNSQNSEFITKFVIQQLDKMFQYARPIEQIEQVLSLYQYAVQ
NAKTDDNKISQKIIEDFYKRIVLQELPKYQTEEYITLRSKLNINSFPFDKVSIQEKIPNY
ELSNRNQTVDHSIQGLCCNMHVTKYNSVNCYNVDFTNQVQVNNLALSFESEQKGLYKIGV
RVIVPNLQGKEQIIYERFYDELYFQQLCEKAENAKVIEYFHNKSDASQSQNEDNILNRED
LGLNTIYLDLNSIKTRYMKIQVEFLDTYRTIHKVVPMTQIFVRPEFFGRTIAQHLNGSQE
QEAINKLFKIPEIEEASLVATLKFKNAEYLVHLIQNDQLSIQHKSCLIKVQYHDRISQDS
SAKNDETQHVEQTEEQLNERLKKIEALQVEFRQTILSKNLKNISKKKIRAQNYEIVNMMR
HFSQFKQDIGLRYLLKLAELLANYSLKINSKDGVNFGENLNISDVYLNLFKRFSVFDIKS
QYPNIQKLLENIFEKVSNKPDFICQLFSEYLLNQNINYNQRNVIAFIKGMKNIDLNDLLL
GFAKVFKLEIDDQVLLNSQKATIKDIDQVITRISSLQHSQKQQISTQAIMGFLSIVDDLN
LDEKILPNERIRYAYQVMIKYLELPGVKISEIIARSQIDLIFMKILILKNNDKEVQKLHR
KLISHLGMHDTNQHLVDSVSTVLKWYEQNENPVLKNFYSQYGNESESMYYRHLAMIFKQY
GILQKSIQLSGKPLQDGQAGQQLSSITSNLLKVLISNQNSPNYEENFYFIWSQIFKQALK
SSHKIQGLNQSIDKMMSEFFKLQPIHMEQLYPKFVKSTEKFVKQSNDSISSLIPIIQYIL
KNGFSETSQNGSQKNLIQNAAFNFADSLISIMISSSPQKQNTSTNISVKLDKETSKQLLS
VVSWYLNTYVNDGYYFGINGANQGTIMKLRIAVGLSKLLSLPNSNGEDAFTIYIQQDDED
LEQLIGSLVKWSFNNFSNQKTKSTPAGQLIYSLSQLVDQMLSKIGRYESAVNKCLPLLMK
NVLRIDVKLRDLIASEQINQNRSVQIQKNVNELFLQYFKSWIQSDEVAKRFLTELNGFDF
LLDRLFSNESVQVSESSESNLNLIEQIGLNKEANEEGANSSDDEEDEENQLMKLILEKLK
IKDQTKGKPKQQQSKSIEDSSKKLKKLPTMVKQDAIVSSDSPSNKADQAITKIEQKLNVD
DWGKNIKLIQTSDSKPVPVQHDPTVWIKYKSGLKQRVHNALLSDESQEYEYSMVFDLGEV
IQITEIQMGVVFSWTTYDQDQNYEPLTILLEGGMSQNNYEFKSLMSSIKDYGFESNQVRP
YGSIFYPVGNTDQSQTLEDQIANFGKREARYLKIRFRRVIQTNLDQSSFMNQVAKAKSIG
ISFLSVMGTQPIKSQLVFQHLIEIQKENSLEVLSKFFSGEFTQAFELISEQPQIILKIQN
AFDKLAVLLDTKAELIKPIFIAICSKNEQLGDWIMINRLLKLQTDAIKKEQIKFLGEIIS
SNKKTQYDKLMKLKDFIFDSVKIILSIEQVAEEKLDKIKLLKRFMKLFIQKLREYSNYIS
SKSDSKTLTLNFQEQNILEIISLLQFTDEKTLSLQNAIITFALQFISPPNNFVNDTISRE
DFVRNLLKDYSPSKLLIASIISASNTDCMKILLQSDVLKEKILNALSDQKIEMQLAQNTA
QIILNCTQNSLFLDTINKSEIIDTIYNFMKIQANHDSTEKTDQKLLNKNQLNDQTLNLLV
DTLKQLFIMDTDVQIKYSQILKEDMKLASQIGDVEFISKVIVPILHSEKLENISISVRDP
ATSRVKSFFEGEKIQAKQDTFFLKSSILNSKQKKTLDKAFREITQDKVETAKLVKSKWEL
IYEDSNVQTKSQPEFLKFVKAVSNKSNVFILLKAKILEQEVVFGGYTCQPFPNLDGQLTQ
EFDYQIPFSEANFVFQYNTDKELHYTMTHNKPFGYIYTDYESSGALSISGDFFLISWSQE
FSNTCGNIYDMKCIEDPSVITMYNNMNIIDIEVFHCDLNQKAPPSGGVTQLKELKKHKFY
QPLSPFNYQSENLVFKVSEDMSLEQISLEILGKKSQFIKPRSPDDEVEETQFYDRSSKLK
DAIERDQLACVHNLLIQQSDKNEDEDKKQVQTESQLAYTPNKPMLQLFIQNGGIIDLLQA
AKAAVSQYEIEEVKNLWELWILEIESFNSFPNFFQLFTKDPSKEQVIYQLLSGECDIKKQ
TNPNPNDLKKKIKDQEELHLEMVTHTYRILSQVFETQESSELRDKCLKNDTFLRFIERIG
QLTSEKKRIKAQKTEQIIESPSKIVDDQDKQMKKNTFIEDKNKVKKGVGYTTGVDTAWNI
NEYLKSKESKNQQIANIMNILTSIIKSQDWQAPQEVKDMILESALLPALEAGFRSGSLLE
MAKDYELNISYLEFVKELSNHQQLLDLLLDIGEDYEPRQKESIYQLLKNIGGLSTIFLSC
LNTESADKSNESEDSKKPKILAERIITTMELVEQKLKANQSLINKQSLDEILEMPLSEAY
HKLLSNLRFEYMNVKNSAGIYAHYYVHDIPKGANPPVSKLVRLAQEIADLSNSLPCDWTN
AIFCRVDKERVDVMKCLIMGASGTPYAHGAFIYDLFFENTYPNGPPKCTLVTTGGGTVRF
NPNLYTNGKVCLSLLGTWRGSSTENWDPKLSTILQVLLSIQAIIMSNEVYFNEPGYEHEQ
GTPEGEQKNEGYSNIVRYCNVKFAMIDAIKNPPAGFEKVIKRSFYLKKNEILREVKEWVD
RAKVTDATYQGLVYDHNYHWAPQISPEGKYAQLMEEAYKELKETLESLTSPFEDESGKQI
QRKFSSREDDPEQSAQGGKNMKLDDIDVSYDPTSKEQIEQSIDINDEKVKDRWSRYIGAM
GIEAVAKQAESRILLQGLGPLGIEIAKNIVLAGCKELILTDRTNVRAADQSGQFFIDNND
LQKLKFRDQSSVAKLQQLNYYVKVSVMDKSKSVVDFIKETKDLKVVVLTELYESSFVNEV
NRICREKGIQFIYACQNGVFSKVFTDFGKEFIVLDKDGEELQEVLIKDISYEEKSNSSIV
TLLEGYKHRYQDGDIVTLKEIQGMQKKSDMSDSLNNSQSRITVINPTSFKLNDVDIREYS
SYEGSGVAKQIKVPVTINFKTQKEIESLESPALDENLAIYDFTKMENQLILHEIYKVYEN
VKRNLANAGLIEQILDLFKYLYKEEDSDEKKKKIKEMLEIFLLTQSYQLPPICAFIGGVV
SQEIVKGITQKYMPINQLFYFDCMELFPIEKLQELIEEQSQCLFKESGDRYDGLNLILGK
DLVNKMFNCKLFMIGAGAIGCELLKNYAMLGLGTGTEGQIILTDPDVIEVSNLNRQFLFR
EKHLRKPKSSTAAAAAIQMNPNLKNHVIARLDKIHDGTSHIYNESFFKEQSIVTNALDNV
AARLYIDGKCVAARTTLIDSGTLGPKGHVQIVLPEYKTESYASQNDPEDNTEIPHCTLKM
FPEEILHCIEWAKDIFGKLYTLQPQVVNKYLEQKDPINFADQQELANIKKVINTLDKKPP
NFLECVRLARKRFQKHFVNDIKQLLHVYPLDKVTKDGRPFWSLPKRPPHPVEFDKDNQTH
VDFVAACTLLYATIYGSEIPDSYVNPRSQEVKQAIAQIAAICEQPEFIPNDQKATAIQSQ
VEKDPSKENSEMEKQNDSQQIDTSTTHQQEDQIQEIKLKYENVLNGLKEAQAEYGSTKPY
SMQVQEFEKDNDSNYHIDFIYAMANIRAQNYNLQGMDWIDVKIKAGRIIPALATTTAAIA
ALQTLEVLKYLKGCKLDDHKNSFMNLAVPSLMMSEPGAALKTKLKEGLEVTLWDRWEYDA
SQDPLNVTLLSILSTTESKYNLKSRDVFLGSFPLFLHALEGRDEGMKIKNLSGVPLIEKL
PQNQGLSKLDIEVPDFVDLTVTFVDEGKFDENGQEKNLEGVPQLRVIFKKL