Identifiers and Description

Gene Model Identifier

Contig289.1.g65

Standard Name

None

Aliases

Contig289_1_g65

Description

PAS domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006769306.00054123732624e-104PAS domain S-box family protei
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig289.1.g65(coding)
ATGTTAGTATGTGACAAAGCAACCAGTGGGGACCTTGTCCATTACATTTACGAAGAATTT
GAGTGTTGGACTGGTATGCATATTATTCATGCAGCCTTCGGAGTTCTGGGAAGCGTTCTA
ATTGTCTTAGAGGCATTAGTTATTTCATTAACGTATTACAAACCAATGGGGTCAGCAAAT
GATGCAAGCACAAAAATAAATTCAAGAGCGGATACTTTCGTATTAATTGAGAAAATAATA
TTGGCAGTTGTGTTTCAAAACCTTAGAAATATTAGCTATCAGTGGGTTCTAATAGTCTTG
ATATCAGTTCTCTCATTTGTAGCATTTTTGAAATATTACACCGAATAACCTTATCACAAC
GAGAGCATTGGCACAACTTTTAACTTTTTATCTGCAGTATTTGCATGGGCCAACACAGTC
TTGCTAATCTCTAAAATTCTCGAGGAATCTGCTTTCAATGGCTCTCTTCAAATGTTTTTT
CTTGGAATACCTTTGATATTCGCACTTATCGTTTTTAAGAAGGACGAAAGAGTGGACAAT
TTAATGCTGAATGTTAGTAATTTCTTGAAAGGGGAGGAAGTCATGGAGCAAGTCCGATAC
TTCATGCAGTTGGTCTCGAAGAAGGACAGCGATAGAAATAGCGATATTATACTCAAGGGG
TATGTGTTTCAACATGAGGACAGTTGTCCGAACGAGCAATGCTAACTGAAGCAATATAAG
TAGAGTATGATAAATACTGCATCAAGTAAGAGTAATAAAGATAAAAGGAAGAAGTAGTAA
CATTCTTAGTAATCACAACTTTAAATGATGTAGAATGTGGATAATTAGTAAATATTAATG
CAACATGCTAAAAATATGTACAGAATTGGTATTCAGAAGTTTCCCACTAATTCTTATCTA
AGAATTGCATATGCTTTTTTCCTTATTGAAAAGATGAACAAGAAGCAGGAAGCCCTTGCT
GAGTTGAATGCAGCATCTTTATTGAATCCTCCATTTGATGAGTAATTTATCATTTTCAGA
TATAAAAAGCTAAGTGAAGAGTATGGAGATGCTGGAGGAACCTCTAGTTTCGCTTCATCT
ATTGAAGACCGCTCCAAATAAAACTCAAAAAGCAACATGGATTTGATGGCTAAATTTGCA
TATGAATCTAACTTCAGACAGCTGTCCATTCATATAGAGCGTTGTGCTCAGTATCATTTA
GAATTCTGGAATTAATTAAGGGAAGAGAGACCAGATGTTGCTAAATTAGGTGAGTCAGGA
TAGCATATCAATTAGAGCATTACTCATGTTGATAACATTTGGAATTCACTCTAGAAGCTT
AACTCTAACGTGCCTAAAGCTCTAAGACTATATGGAAAGTACTTAATGGAAATTTTACAC
GATAAAGATGGAGGTATAGATCTGCTTTAAAGAGCTAAGGATGCAGCAAACGTAAAACAC
AATTATTACGATGGTGCCGGCGGAGGAGGCATGTTAGAGGATTTAAATGATATACAGTAT
ATGTCTTCAGATGGTACGCCATGTATTTATGTTAGTGGAGACCTGGATAAAATTGGAATG
ATCACTCAATCAAATGCTGGGGCTACTAGGATCTTTGGATATCAACCATTAGAAATAAGG
AATCACAATGTTGAAAAGTTAATGCCAGAAATGTATGCGAAAAATCACTCGAAAGTATTG
GAAGATGCATTAATGAAAGGTCCAGAAAACATTCCTAATAAGGAGAGATTAGTTTTTGCA
AGACATAAATCTGGCTACATATTTCCAGTTTGGCTTTAATTAAAAATGGTGTAGAATATC
TCTAATGGAGTTCAGTTTGTTGCTATGTTCAAAGTAGATAAGAAGCTAATGTCATCAAAC
ATTGGTTTCATTTTACTGAACAAAGAGAAGAAAATACAAGGGATTTCTTCATCTTGCATG
CGACTAATGAACTTGGACCTAGCTAGAATGCGCAGATTGACTGGAAATGGATATGACTTG
AATAAATTGGCTCCTAGTATGTTTACCAGTCCAGAGGAATTTTTCTATTCCCATTCTTCC
AGTAAACAAGGTGTATAAGTTGAGTGGAATATTCCTAAATTTGAGAGAAACAAAAATGCT
CCAAGATTGCCCTAAATGGGTACACTTAAAGCTAAACAGAGAAGCACAGGCGGTAAAGAT
CTAAGATAAGGTACGCTTATGAATAGCACAATGACTAATAATCAAGGCGCTCATTAAGAT
TAGGATACTGGCACATTCTCTAAAGAAGGTAGAAGTTCAATTAAGTTTGGGCTTAATAAC
AATAACAACTTGAATAATTAACTGTAGAGTTATACAGTGATAGATTAGAAGTTTACACTA
AATGTTTCAGTGAATAACATAGTAATGGGGGAATTAGGAGAAATAGGTTGGTATTTGAGA
ATAGATGGGTTACCTCATGAAAAGAAAGGCTAAGTTATTAACGAATTTCCTCAATCAAAT
GCAATAAATGAAGGCAATACTCGCCATAAGCCGACACATTAGCAAAGAGAAAGAGTCAAG
CAACCTCTGTTTTAATTCAGATATGATGGAGACAGTGGTCGATTTGTAAGGGAACTCAAA
GAAAGCCTGCATGTAGATAATGCCATAAAAGACCCTAATTTTATTGATGGAAATTTTGCA
ACTCCAAACTATATTGACTTCGATAGTTCACCAAAGAATGGGGAAGACAAAGAAGATCAA
GATGTTTCCCCTATTATAAGTAAGAGTGGCTAGAAAGGCAATGAGAAGTTGGATGTTACA
GATATAATGATAGATATAAAGCCATCAAATGAACCCTCAAAAGACAGTTAACCACTAAAC
ACAACCACAGGTTACGATCAGTTAACAAACGAAGATTTATACAATCGCAGGAGGCAGTGG
GCTCGAGGAATATAGATATACAGACTACTTAAAGGAAAGTTTGTGCCCAAGGACGGAGAT
GAAGAAACCAAAAAGGAAAAGTAAATCGAAGATGAAAGAAAGAAAAAGTTACATCTTGAT
GAGACCAATTTGTTGTAACTTGACACTTTCAAGACTAACATAAAATCCAGGAAGGCTTTA
CATATGGCTATTAACGATACCACAGTACCTCCAGCTATTAGAAACTTGAAAACTACTATG
AACTTAGTCATAGTTTGCTTGCTTGCCTTGGCAATCACGGAATTTATCATAATTACTGCA
TAATTCAAGGATATCAATGAAAACTTCAATCTTATCCAAAAGTCATATGGCAGGGTTTCG
GAAGTACAACGAGTTGCTTATGATGTGAGAAGTTTAATATTAATTAATGAAGGAAAACTT
AAGAATCTGTAGAGGCTGAGTAAAACAAGCGATTTCACAAACTTTCTAAAGAGTGACATA
GAGTTGGCTCTTAACTAAATATACGAACTACAAAATTACATTAGTTTGTCAACGCTAAGT
GTTAGTTAGGACCATTAGAAGCTTTTGGAATCCAAAGTTGTTCCTTTATACTACAAAGAA
AGCAATACAACATTTAAAATCTTAAACTTTTCTCTGACTGAATCAGTCCTGCAAATATCT
TCAGCAATATTCACAGTTAGACATTTAAATATGTCTGAATTCTATGAGTTGCAAGAAGAT
GTATACTTTGTTACCTACAATGTATTCAATGATTTCTTGTTTTATCTCAGGATGTCTAGT
GACTACTATTTACATGAGTTGACAGATAGATCTAATGAGAAAAATCGAGTTATATTGATA
CTATTTCTCTGTTCAATTGGTCTGGTTATCCTTTCTCTACCAATACTGTTTCCAGCTGTG
TCCTCAGTAAATAAAGCCAAAATACATGTACTTTCATTGTTCTTAGACATTCCAAACAAC
TTTATTATTGACATTGCTAATAAATGTGAAAGTTTCCTGAACTAATATCACGATGATCAG
TAGATGGACGAAATGCAGAGTGAGGATGATGAATTCCAAAAGAAATAGGGGGAGAAGGAT
TCTTCTAAAAATGCATCTGCATTAAAACGTGGAATTCATAAGCAAGCCAAGAATACAGCG
CATACCAATAGAAACTTCTTCTTATAGTTTAGTTTTGCAGTGTTTGCAATTCTGGCATAT
TTCATAGCAATGTTCATTCTTGCAAATGATTACATATCAGATATTGAAATCCTTTCAGAA
GAAATGAAAGTTGGAGCTTAATTAGAGTCATATTTCGCATTTGCTTAAAATACTCAAAGG
GAGTTGCTATACAATCCATAAAAGAAAATACTCAATAGTCAAGGATTTAATGTCTCAAAA
ACGGCAATTGAGTTTCTGTTTAACCAGACTTAGAACTTGCTGAACTCTCATTAATCAAAC
CGAAACATCTTAGATCAGGACTACCAAGACAAATTTCACGAGGCCTTCAATTCAAACCAG
TGTAACAGCAATCAAATAAGAACTGACTTGTTACCTCAAAGTTGCAACTAACTCTTTAAC
AATGCGAGCTAGCATGGACTTGAAACTGTTCTTGCTAAATATTACGAGACACTGAGGGAA
TCACTTTAAATTTACAAATAGCTTAATACCAATGTCACAGTTACGAGTGGTAGTAACAAA
ACATAGTAAACAAGTTAAGTTGTGACCTTAAATGGTCAGACTTATAGAACAAATCAGGAT
CTAGTAAATTCTTAATTATTCGTAGATCTCTATCTCATGCAGTTTAGATTTATCTAAGAG
ACCTTCAGGAACTTAGTGATGCTTCTAAAAAATGCAGTCAATTAATCATACAATGATAAT
ATAGATACTCGCATGGCTACTTTTATCATTTACATATTAGTTGTGGTACTTGCATACTTG
ATTTTATGGACTCCTTTCTTAGGAAAACTTAACAGAGAGATATGGAGGACAAAGTCTATG
TTGACCATAATTCCGATTGAAATTATTATGAAGATACCCAAAATTTAAGAGTATCTAAAC
AGACAAGCTATGTTTAACAATAAGAAGCAAACAGCAGGTTGA


>Contig289.1.g65(protein)
MLVCDKATSGDLVHYIYEEFECWTGMHIIHAAFGVLGSVLIVLEALVISLTYYKPMGSAN
DASTKINSRADTFVLIEKIILAVVFQNLRNISYQWVLIVLISVLSFVAFLKYYTEQPYHN
ESIGTTFNFLSAVFAWANTVLLISKILEESAFNGSLQMFFLGIPLIFALIVFKKDERVDN
LMLNVSNFLKGEEVMEQVRYFMQLVSKKDSDRNSDIILKGYVFQHEDSCPNEQCQLKQYK
QSMINTASSKSNKDKRKKQQHSQQSQLQMMQNVDNQQILMQHAKNMYRIGIQKFPTNSYL
RIAYAFFLIEKMNKKQEALAELNAASLLNPPFDEQFIIFRYKKLSEEYGDAGGTSSFASS
IEDRSKQNSKSNMDLMAKFAYESNFRQLSIHIERCAQYHLEFWNQLREERPDVAKLGESG
QHINQSITHVDNIWNSLQKLNSNVPKALRLYGKYLMEILHDKDGGIDLLQRAKDAANVKH
NYYDGAGGGGMLEDLNDIQYMSSDGTPCIYVSGDLDKIGMITQSNAGATRIFGYQPLEIR
NHNVEKLMPEMYAKNHSKVLEDALMKGPENIPNKERLVFARHKSGYIFPVWLQLKMVQNI
SNGVQFVAMFKVDKKLMSSNIGFILLNKEKKIQGISSSCMRLMNLDLARMRRLTGNGYDL
NKLAPSMFTSPEEFFYSHSSSKQGVQVEWNIPKFERNKNAPRLPQMGTLKAKQRSTGGKD
LRQGTLMNSTMTNNQGAHQDQDTGTFSKEGRSSIKFGLNNNNNLNNQLQSYTVIDQKFTL
NVSVNNIVMGELGEIGWYLRIDGLPHEKKGQVINEFPQSNAINEGNTRHKPTHQQRERVK
QPLFQFRYDGDSGRFVRELKESLHVDNAIKDPNFIDGNFATPNYIDFDSSPKNGEDKEDQ
DVSPIISKSGQKGNEKLDVTDIMIDIKPSNEPSKDSQPLNTTTGYDQLTNEDLYNRRRQW
ARGIQIYRLLKGKFVPKDGDEETKKEKQIEDERKKKLHLDETNLLQLDTFKTNIKSRKAL
HMAINDTTVPPAIRNLKTTMNLVIVCLLALAITEFIIITAQFKDINENFNLIQKSYGRVS
EVQRVAYDVRSLILINEGKLKNLQRLSKTSDFTNFLKSDIELALNQIYELQNYISLSTLS
VSQDHQKLLESKVVPLYYKESNTTFKILNFSLTESVLQISSAIFTVRHLNMSEFYELQED
VYFVTYNVFNDFLFYLRMSSDYYLHELTDRSNEKNRVILILFLCSIGLVILSLPILFPAV
SSVNKAKIHVLSLFLDIPNNFIIDIANKCESFLNQYHDDQQMDEMQSEDDEFQKKQGEKD
SSKNASALKRGIHKQAKNTAHTNRNFFLQFSFAVFAILAYFIAMFILANDYISDIEILSE
EMKVGAQLESYFAFAQNTQRELLYNPQKKILNSQGFNVSKTAIEFLFNQTQNLLNSHQSN
RNILDQDYQDKFHEAFNSNQCNSNQIRTDLLPQSCNQLFNNASQHGLETVLAKYYETLRE
SLQIYKQLNTNVTVTSGSNKTQQTSQVVTLNGQTYRTNQDLVNSQLFVDLYLMQFRFIQE
TFRNLVMLLKNAVNQSYNDNIDTRMATFIIYILVVVLAYLILWTPFLGKLNREIWRTKSM
LTIIPIEIIMKIPKIQEYLNRQAMFNNKKQTAG