Identifiers and Description

Gene Model Identifier

Contig2834.0.g88

Standard Name

None

Aliases

Contig2834_0_g88

Description

impB/mucB/samB family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004553094.001709789838121e-126DNA polymerase IV / kappa
SGDYOR346W0.0000000020002373268528243REV1 SGDID:S000005873, Chr XV
from 981828-984785, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2834.0.g88(coding)
ATGCTCAAAGACTGTGAGGATTTCCTCTATGATATATACACAAGTAGCTTACAAAACTCT
CAAGCAATTCAACAAAATTAAAACTAAATCAATACTTAAAAGTCAAACAATATTGAGGAA
GTGAAGTAAGAAGAAGCTTTTGATTACTATTCTTATCAGAAATTAAACAATTAAGAGGAT
TTTCATAATTAATTGCCAACAAATCTTGTCAATAATGACTAAGACAAAAAATTATTAGAT
AATGCACCAGTGTTACACTATGTTGCTTTTAAAGCTGGGATGGACTCAATTGATAAAGAA
AAGATAAATAAGTTTATTCTTGAAGCTTCTTCAGGCTCTTCGTACTACAAAAGAGAGATT
CAACGTACTGAAGCAGCAAAGGTCAAAGCTGACATAATGAAGGCTAAAATAAAAAGTCAC
TAGAAAAATGAGAGATTGTGGAAGTAATCCTCACAATAAGCCAAGCAAATAATGATTGAT
GTGCAGAAAGACAGAGATCTCACTAGAACATGGATGCATATAGATATGGATATGTTCTAT
GCTGCAGTGGAGATTAGAGATAACCCTGAGCTTGCTGATAAACCAGTCGCAATAGGAAGC
TACAGTATGGTTTCAACAGCTAATTATGTGGCTAGAAAATTTGGAGTGAGATCTGCCATG
CCTGGATTTATAGCGAAGAAGCTTTGTCCTGAATTAATATTTATTCCCAATAATATGAAA
AAGTATAGTAAAGTATCAAAGGTTTTCAAAGGCATCTTAGAGCAATATGATCCAAATTAT
GAATCTCTAGGTTCAGACGAGGCTAATTTAGATATAACTGATTATTTAAATGCTAATAAT
ATGAATGATGATGAAGGAATTCAAAAGCTTGTATTTCAAATAAGAGAGCAAATATTTTCT
ACAACCAGACTTACATGCAGTGCAGGAATTGCCTGTAATAAGATGTTAGCTAAGATTTGT
ACAGACATGAATAAACCCAATGGCTAAACTTATTTAAAGCCAGATGAGTAAACAATTCTT
GATTTCATGAAAGTTCTATCCGTGAGGAAGATTCCAGGAATTGGAAGAATGACAGAACTC
ATTCTTGCTTAACTTGATATATTTACATTATAGGATGTTCTGGATAAACAAGTTTAGATA
CAAATAGCTCTAAAAGAGAGAACTGTGTATTTCTTATTTAGAGCAGCTCTTGGAATTTCA
AGAAATTTTCATGAGGAGGAAGATGACGACTGTTAGAAGAGCATAAGTATTAGTGAGACA
TTCAGACCATTAGTTACACTTGAGCAGTTTAAAGATAAAATCAATTAGTTGTGCACTGAA
CTTGCGGAGAGAGTGGATAAGCGAAAGGTAGCAGGACTTAACATATCTTTGGAGATTAAA
ACTACAGAGTTCTCTGTTTTGTAAAAATCATTGACATTGAAGAGTTACATCTGGACTTAG
GAGGATTTATAACTATACTCCCATCAACTACTTGAAATTATGTGGCCTAGTAAACCTGCA
AGATTAATTGGAGTTAAATTGTCACATCTTAAGAATCAGCATGAAGTGAAGAAAGACAGA
AATATTGGTGGATTCTTCGACAACAAGATATCAAAAGAAGCTTATCAAAAGATAAACGAA
TAAAAACTTTAGTAGTTGCATGACGAGATTAAGAAAGACAATTTTGATGATTTGAAAAGT
ACAAGAGTATAATATATTGATTAAAAATAAGAATTTTCTCCAATCTTAATTAGTAAAAGA
GGAAGAAAACCAAAAAATCTTGGGAAAATAGTTTCAAAACATGCTGACAGAGGTAATTAA
GAGCTTTTGAGTAAGAAGAAAATGCTTGATAAAAAGTAAATGATCAAAGAATCTGCTAAG
TTTTCTAAACAAGAGAGGCAATTAAAAAGCGATTTAAGAGTTATAGATGAGGATAAACTT
GGGTTTTAGTTTGATATATAAAATTCAATAGTTAAAAAAGATGCGAATGGAATCAATTCC
AATAATAAATAGTAGAATATTGACAAAAACACATCTTCATTAATTAAAAGAGGAAGAGGT
AGGCCACCAAAAGATCAAAAGTAACTTCACATTGAAAAACCAAGTTTAGATAAGTCTTTC
AAAAAATTTTATTAATGA


>Contig2834.0.g88(protein)
MLKDCEDFLYDIYTSSLQNSQAIQQNQNQINTQKSNNIEEVKQEEAFDYYSYQKLNNQED
FHNQLPTNLVNNDQDKKLLDNAPVLHYVAFKAGMDSIDKEKINKFILEASSGSSYYKREI
QRTEAAKVKADIMKAKIKSHQKNERLWKQSSQQAKQIMIDVQKDRDLTRTWMHIDMDMFY
AAVEIRDNPELADKPVAIGSYSMVSTANYVARKFGVRSAMPGFIAKKLCPELIFIPNNMK
KYSKVSKVFKGILEQYDPNYESLGSDEANLDITDYLNANNMNDDEGIQKLVFQIREQIFS
TTRLTCSAGIACNKMLAKICTDMNKPNGQTYLKPDEQTILDFMKVLSVRKIPGIGRMTEL
ILAQLDIFTLQDVLDKQVQIQIALKERTVYFLFRAALGISRNFHEEEDDDCQKSISISET
FRPLVTLEQFKDKINQLCTELAERVDKRKVAGLNISLEIKTTEFSVLQKSLTLKSYIWTQ
EDLQLYSHQLLEIMWPSKPARLIGVKLSHLKNQHEVKKDRNIGGFFDNKISKEAYQKINE
QKLQQLHDEIKKDNFDDLKSTRVQYIDQKQEFSPILISKRGRKPKNLGKIVSKHADRGNQ
ELLSKKKMLDKKQMIKESAKFSKQERQLKSDLRVIDEDKLGFQFDIQNSIVKKDANGINS
NNKQQNIDKNTSSLIKRGRGRPPKDQKQLHIEKPSLDKSFKKFYQ