Identifiers and Description

Gene Model Identifier

Contig261.1.g30

Standard Name

None

Aliases

Contig261_1_g30

Description

BT1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003900803.000745802558524e-63folate/biopterin transporter f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig261.1.g30(coding)
ATGTTTTAAGGTGACGAAATAACTAACAAATTAATACAATAATAAGATGTCTCTGGTGAT
TCATAAAATCCTGAGTAAACTAGGAATTAATTGCATTTTTCCTCTCAAGATTTCACAGCA
TCATCTTAATAAATAATAAACCATTGGCATAACGATGCCCAAGATATCTTATCACCAACT
CAGGATCCTTAGGAAAATAAAAGTGATAAAATATCTTAAGAGATGCTTCTTGATCAAAAA
GGTTTCAAAAGAAATCAAATAGTAATCTTAATTATAGCTCTTTGTCTAGGGTTTTCTACT
TTCCCAAACCTTTCTATAAACTACTTCTTTATGGATAACTTGAAACTAGACCCCGCTGAG
CTCTCCTTGTTCAATTCAATCATTAATTTTGTGTGGATTTTGAAGCCAATTTTTGGGTTT
ATATGTGATAGCTACCCTATATTTGGCTCTCATCGCAAAAGTTACCTGATAATCTCTTCA
ATAGTTTAAGGTCTCGCTTGGATTCTATTAGGAGCTTGGGTAACAAACTTGTGGTAAGCA
ATTCTCGTGAAAACTGTTATTAATATTTGCACAAATTTCTAAAATGTAATTGGAGAAGCC
ATCATGGTTGAAGCTTCCCAGAGAAAAGAGGAGAAAATTTTGAGTGGCAAAGAGGATGAG
AAGTAAAAGAAAATGCAAAATTAGAGAGGATAGACTTAATCTTAAGAGACTGTTGATGTG
GAAGTAAATTAAGTTAATAATTAAGGTGATTAATAACCATTAAATTAAGACCAAAATAAT
GAGCAAGATAATCAAGAAGAGCAATCAATTACTGCCAGATCCTCGATAGCACGATATGAC
AATAAAAATACAGCAACAAACGTTTCTATATATCTTTCACTCACAGCTCTCAGCTCTCTT
ATATCATCTTACTTTGGCGGTAAACTCTTGGATTTTATGACTGTTCAGTAAATGTTTATG
ACAACAGCAGTTATCTCAGGATTCACTTTAGTATCAGGCTTCATTCTCTTTGAGAAAGTT
GGAAACAATAAAAATAACTTTGAGAATCAGGAATCACACTAATAAAAAGTGCCTTTCTGT
AAACTTGCAAAGGATAATTGGGGTAAAATATCAAAATTCCTTAAACTGCCTTTCATCTAT
AAGCCCCTGATTTTCATTTTCTTGGTAGTTATAGCTCCAGGAGTAGACGATCCATTTTTC
TATTTCTAAACTAAAGTTTTGAAATTTACCAATAACGATTTCTCTTACATTAATGTTATG
TGCTCTTTAGCAAATATTTTCGGTGTGTGGTCTTATAGATTTTTCTTCAGAAACGTGCTC
TTCAAGAAAATGATATTCATAACAACTATATCATTCGGTATAGTGCAGATTTCAAAACTT
ATGCTTGTTTTTTAAGAAACTGGATACTTGGGTATGTCACCACTTGTTTACACTTACATC
ACATAATTCTTATATACTTTTATCAATGAGCTACATTTGATGCCAATTATGATACTTGCC
TGTAAAATGTCACCTAAATCAGTTGAGGCTAGTTTTTACGCTTTTGTTCTAGCAGTTATT
AATTTGGGGTATTTGGTATCGTACCAACTTGGTGGTGTTTTAACTTTGGCTCTTGGTATA
ACAGCAACTGACTTCTCGCACTTATGGATTTTAGTCCTAATTGCAACTCTCTTCCCACTA
GTCACACTGAATTTCCTACTTCTAATCCCCTCTAAATTTGATGTAAATGAAGAAATAGAG
CGATACTTCAGTCAGCAACGCCGAGTCGACGAAAAAGAACGAATGAACGAGCAAGAAAAA
TGGGTGGAGACTGGCAGAGGCAGCTTTATTAAAGTCAAAGGGAATATCAGAGAGGACTTC
AATAATGATGAATTGCTGGTTGATGCTTTGATTGAAGAGGGACATTTATGA


>Contig261.1.g30(protein)
MFQGDEITNKLIQQQDVSGDSQNPEQTRNQLHFSSQDFTASSQQIINHWHNDAQDILSPT
QDPQENKSDKISQEMLLDQKGFKRNQIVILIIALCLGFSTFPNLSINYFFMDNLKLDPAE
LSLFNSIINFVWILKPIFGFICDSYPIFGSHRKSYLIISSIVQGLAWILLGAWVTNLWQA
ILVKTVINICTNFQNVIGEAIMVEASQRKEEKILSGKEDEKQKKMQNQRGQTQSQETVDV
EVNQVNNQGDQQPLNQDQNNEQDNQEEQSITARSSIARYDNKNTATNVSIYLSLTALSSL
ISSYFGGKLLDFMTVQQMFMTTAVISGFTLVSGFILFEKVGNNKNNFENQESHQQKVPFC
KLAKDNWGKISKFLKLPFIYKPLIFIFLVVIAPGVDDPFFYFQTKVLKFTNNDFSYINVM
CSLANIFGVWSYRFFFRNVLFKKMIFITTISFGIVQISKLMLVFQETGYLGMSPLVYTYI
TQFLYTFINELHLMPIMILACKMSPKSVEASFYAFVLAVINLGYLVSYQLGGVLTLALGI
TATDFSHLWILVLIATLFPLVTLNFLLLIPSKFDVNEEIERYFSQQRRVDEKERMNEQEK
WVETGRGSFIKVKGNIREDFNNDELLVDALIEEGHL