Identifiers and Description

Gene Model Identifier

Contig2564.0.g105

Standard Name

None

Aliases

Contig2564_0_g105

Description

Dynein heavy chain and region D6 of dynein motor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03028 ) Dynein heavy chain and region D6 of dynein motor
  • ( pfam08393 ) Dynein heavy chain, N-terminal region 2
  • ( pfam12774 ) Hydrolytic ATP binding site of dynein motor region D1
  • ( pfam12780 ) P-loop containing dynein motor region D4
  • ( pfam12781 ) ATP-binding dynein motor region D5
  • ( pfam12775 ) P-loop containing dynein motor region D3
  • ( pfam12777 ) Microtubule-binding stalk of dynein motor
  • ( pfam07728 ) AAA domain (dynein-related subfamily)
  • ( pfam00004 ) ATPase family associated with various cellular activities (AAA)
  • ( pfam00437 ) Type II/IV secretion system protein
  • ( pfam13207 ) AAA domain
  • ( pfam13191 ) AAA ATPase domain
  • ( pfam13555 ) P-loop containing region of AAA domain
  • ( pfam00910 ) RNA helicase
  • ( pfam13481 ) AAA domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001935209.997093137033517e-262Dynein heavy chain family prot
ein
SGDYKR054C9.997093137033517e-262DYN1 SGDID:S000001762, Chr XI
from 547925-535647, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2564.0.g105(coding)
ATGGAATAAAAGAAAAAGGATTTGCACAGTTAATCTGTAAGAGACCTTACTTAATCTCAG
TTCGTCATGAACAGAGATGCTTCAGATTTATAGTAAAAATTGCTTGCACAAAGATTGTAT
GCAAAATACTCTGATACTGGCCATATTATACCCAACAAATTGGTGGGACCTCCAATGCCA
AGTGGATCGTCAATTCTAGGGTCGCATAGAAGAAGTTTACAAATAGATGACTCTGTATTA
TCACTAAACAAGAAATCCGCATCCCTTGCTAGATTTAAGAGGCCAGAGGAATTGATGAGT
CCTGATGCCTAGGAAGTCAGAAAGAATTCACAAATGAGAGCTAAACTTCCAAAGATTCAA
AGTCGAAAGCATATTGATATTAGCTAGACACCATTGCCTACTCTACCTTTCCCAAGGGTT
TTAGGAAAAGATATTATTTCACCATTCCCTGGTAGTTAAGATCACCTTGCTCTTAAGAGA
ATTATTGCTTAACACCAAGCATAAGCCTCAATTTTAGCCGACAGTTAAAACTTAACAGCT
TCGACTTCATAGTAAATTTTAAACTCTTATCGTAATGGGGCATAAGGATCAGGCTTTTTA
GCATAGTCTCAGTCCTAATTAACATTGAAAACTGCCCTATAAAATCCAACACACAATTAA
ACCCTTCTTCACAATTAGTCTACACTCTCTCTGATATCTCCAAATGATAAAACTCTTGCT
ATTCTTGAGTCTCATTAAAGAAGGAACAATAGAACTTCCCTGACTCATCACCAATCTTTC
TAACAGTTACTGCCAATTGATAATTCTAAAATTCTTAACAGTACTTTAGAAGCTCATGGT
CAACACCACAATGGCACACATGACCAAACTTAGACAAACGCTTCAGCATTGATACTTAGA
AATGTTCCTCTCCCAAACTACGAACAAACTAAGTAAATCATGACATTTGACCCTGCAAAG
ATCAAACCAAAGCCAACATCTGATATCAAGAAAATTATGGTTAGATAGGGTATGAAGCCC
ACTCCCTTAGAATTCATAAAACTGGTGTAACTTGACCCTGACTTCTAAAATCGTTTTTGC
TATTGCAACAAAAAGGAAGACTTCTACGAATTTGAAATTGTACCATTTAGCGATAAGAAT
GAAGCTGAGTACATGACAGTAAGTTAGAGAGGAGTTGTCCATTTCATCAAAGGAGAGGCG
AACTTTATGAGTATCCCAGAGTGGGAAAGAGAACAAAGAATTTATAAGAATATCTAGAAA
ATTCCATTCTTTTTGAAATACAGAACCTGGAAGACTTTCTCAGCATGGAAAACTTTAATG
AGAAGAACCATGATCTTTAAAACTAGTGATTTCTTAAACAGAGAGCTATTCATTTTAGAT
TCTGAATTAAGCAAGCCCTTACTAGATATTAGAATGAAAACTTTCAACATCCAAAAGATG
CAAATGGTTGCCATGAATACCGAAAAGCCTAGAAACATGCAGGAATTTTTTGAACATCAA
GACAAACAAAGAAAGACAGTCAACGAATCACTTAACAAAATTGAGAAAGAAATCAAAAAC
ATCTTGATTGACTCCTGCGATAGCTCAATGAGAACTTTTAGAGAGGAAAACAGAATATCT
CTCAACGACAACCAAGAGGATGACGACAATGAAGAAGCTGAGCCTTTTCTTGTTGGCGAT
GAAACTCACAAATAAATGCCATACACTTAAGAAGCCACCACTAGAACACACTACAAGAAA
CTTGCTAAGTATATTAGACTTACTGATTACATGATTATTGACTCAAAGCTCAGATTAATC
CAGTATTCTATTACAAATGTTTTGAAGATAGTACAGCTTGACTTTAAACTCCCAAGAAAA
TTCTTAATTGGAGATAAAATTCAACAAGTTCCATTGTTTGAGATTACTATTGACTTTTAA
GGGTTCGATCTCTACTTCAATCCAAACAAATTCGATGTCAGAGATGCCATTAAAAACTCC
ATTACAGAGGGTGTAAATAGCGTATGCAGATATGAGCTTTTCATTAACCAGCCAGAATTT
GAGACATACATTAATGTTCAGGAATAAGAAGACCATCTGTTTGATGAATAAAATGACCTT
ATGTCTCTAGCTATAGGTTCTGATATGCTAATCAGAGACACTGAACTCATCTCTCAAGCA
ATCGATGGAGTCTTCGATGACATGAAAGAGGAAGTGAAGGAGTATGATCAGTTTGTTCAA
ATTTACAATGAAAACATCACCACTACAGCTGAAGACTTCAGATAGAGAGACCATGACTTT
ATGAATTAAAAGATTAAACAACTTGAAAACTAGTAAGAAGAGATTGACAGACTAGATGTA
AGAAAAACCATAAAGGTTGTAAGACTAGACGGTGAAAAAATGAAGAAGAGAATCAGAGAA
AGTCCCAAGCAAGTGTGGAAGATGCTCTAAGATTTCATCCCAAAGTTCCAATTTGAGAAA
TTAGATGCCCTTTGTGAGACTTTAAAATTAGAGTTCAGTAAGATTGCCAATAAACCTCAA
TCAATCGACTAGTTCGTTGTAATTATGAAGGATTTGAACGATCTTAGTGGTAGAATAGAC
AATTTTGCTTCAATGTTCCAAGAAATTGAAGAGTACAACATCTTGATGGACGAGCATAAA
ATCAAACTGCCAGACAAGAATAAATCAAAATTCAAGGAGACTCAATCCCTCTTAATTAAA
ACTAGAAAGTAGATGGAGGAAGGTCTTGAAGCAGGGGAGGTCGAGGAACTTAAGTTCAAA
AAGCAGTTAATTGATACTGAAATTCCTAAGCTTAACAAGCAATCTAAAGCTATTTTAGAT
GAGCTGACTAATGTTATGTTTAGTGACTCTAAAACTTAAATCATGGACGCTGTGAGAAAG
CTTGAAGAAATTGGTGAAAGTGTTACCTAAATGAAAGAAAGAGGAAAATAACTTAATACT
TATTAGAAATTCCTTGAACTCGAAGACACTCCTTTTGAAAGTGTGAATGATGCATTCAAT
GACTGGAACTTGAAGTATAAACTTTGGAAAGGACTGGATGAATGGATTTATCTCTCTAGA
GATTGGGTCAACACTAAATTTACCGCTATAGATGTTGAAGACATTTAGAAATAGGTTGAC
AAATTTTTCAGTTCAGCAAGTGTATGCTATATTAATATGAAAGAAAATCCTGTAACCTAG
ATTTTCAAAGAAAAGGTTGATGTTCTTAAGAGCACTATGCCAGTTGTCAGCTATCTAAGA
AGCGATCTTCAAGAAAGACATTGGATAGAGATTTATGACATTCTTGGTATGACTTTAGAC
TTGAATAACGATGACTTTACTCTAAACAGCTTGATAGAACTCAATGTGAAATAAGAAAAG
GACAAAATAGGTGAGATCGCTTAAAAAGCTGAAAAAGAGAAGGAGTTAGAGGCAACCTAT
GAGAAAGTAGCCGCAGAATGGAGAAAAGCTATCTTCGAGACAAAGCAGCACAAAGATGCC
TACTTTATTCTTGGAAGCACAGAAGACGTTAACAATTTGTTAGAAGAGTCTATGGTTACA
TTATCAAATGTTTTAGGCGCTAGATTTGTAGACATTATTAGAGAATTGGTTGAGCAACTC
TATAAAAAGCTATAATACTTGGAGAATTTATTAAATGAATGGCAAACATTCCAAAGAACA
TGGATGTACTTAGAAAACATCTTCAATGGCTCTGATATTGCTTAAAAAATGGGTCAAGAT
GCTAAGAAATTCTAAACTGTTGACGCTTAATGGAAAGATATAATGAAATCTACTCATGGT
AATCCAGGAGTCAAAAGATTCATCGATAATAATTATAAAGATGGTCAACCATATCTTGAC
TTATTTAAGAACAACAACAAGATCTTAGACGATATTTAAAAGAGTCTTGAAGTATTGCTT
GAGAAGAAGCGTTCAGAGTTCTCAAGATTCTATTTCTTGTCTAATGACGAACTTTTATCA
ATTTTAGCTGAGGCAAGTAGAGATCCAGAGTGTGTCTAGGCACATCTAAGAAAACTCTTT
GAAAACATTAACCGAATTACCTTTGAATATGATGAAATAACCAAGATCATCTCAGCTGAG
AAAGAAGTTATCAAGATTAAGAAAGTAAAGACTGGAGGTAACTAGCCAGTAGAGAAATGG
CTACTTTAATTGTAAGATAATATGATGGGAGCTGTTAAGAAATTCATCAAAGATGCTCAC
TATGCTTATAAAGAAGATGAAGAGTTCAAGAGACATTAATGGGTTATGGAAGATCATCCA
GCTCAAGCAGTCTGTGTTGTTGCATCAATAAATTGGTGTGGAGCAACTGAAAACTTACTT
AAGGATGAAGATGAGGTCAGCGAAGGACTCGCTTGGTGGTATTCAGAGAATGTCAAATAA
CTCGAAGAACTTACTAAAATTGTCTCCAGATCAGACATAGATTCAAGAAAGAGGAAGGCT
GTAGTGGCACTTATAACTTAAGATGTACATTACAGAGATATTGTAGAGGAATTGATTAAA
GAAGAAGTAGAAAACCCTCATGATTTCAAGTGGCAACAATAACTTAGATACTACTATTCT
AATGAAGAGATCGCAATCAAACAAGTTAATGCATAACTAGACTATGGCTATGAATATCTT
GGTGCTCATACTAGACTTGTTATCACACCACTTACTGATAGATGTTGGATGACTATTACT
GGTTCATTGCACATTAAATTGGGAGCTGCCCCAGCTGGACCAGCAGGTACTGGTAAAACT
GAAAGTACTAAAGATTTGGCCAAGGGTCTAGGAAAATATTGTGTAGTGTTCAATTGCTCA
GATCAGATCAACTACAAAATGATGGAACAATTATTCTCAGGTCTGGCTTCAACAGGTTCT
TGGGCATGTCTTGATGAGTTTAACAGAATTGACATTGAAGTACTATCAGTTATTGCTTAA
CAGATATTAACAATCAGAAATGCTATGCTTCAATAAAGAACTGAGTTCTAACTTGGAGAT
AGATATATCGGTCATTTCGTTGACACTATGGGTATTTTTATTACTATGAATCCTGGTTAC
AAGGGTAGAACTGAACTCCCAGATAACTTGAAGGTATTATTCAGACCAGTATCTATGATG
ATCCCAGATTATGCTCTCATTGCAGAAATTATGCTTTTTGCCGAGGGATTCGTCCAAGCT
AAACCACTCTCAAGAAAAATGACAAAGCTATATAAATTAGCTTCTGAATAGTTGTCACAG
TAAGCTCATTATGACTTTGGTATGAGAGCTGTAAAGTCAGTGCTTGTTATGGCAGGTTAA
GTTAAGAGAAATAATCCAAAGATGCCAGAGGATATTGTGCTCATTAGAGCGATGAGAGAC
TCAAATATACCAAAGTTTATTAAGGAAGATCTGCCTCTCTTTAATGCTATTGTTAAGGAT
TTATTCCCAGGAACATAACTTCCAGAATCTCAATATGATATGCTTATACAAGCTATCAAT
GATACCCAATCATAATCAGGCTTGACTTCAGATCCATATTAAATAGAGAAGATTATCTAA
TTCTATGAAACAATGAATGTTAGATTCGGGTTAATGATCATTGGACAAACTCTGACTGGC
AAAACAACAATCATCAAAAGTTTGAAGTAAGCCATGAACCAAATGAGAAAGAATGGTTAC
ACTGGAGAAGATTACTTAGCTGTGGAAAGTGAAACTTTAAATCCAAAGTCAATTAGTTTA
GATGAACTTTATGGTTCTTTCTCGCATTTAACATAAGAATGGACTGATGGTTTGGCATCC
TAACTTATCCGTGGCTTTGTTGAGAAGACACATAATGATATGAAATGGGTTATTTTCGAT
GGACCTGTTGACGCTATTTGGATTGAAAACATGAATACAGTCCTCGATGATAACATGACA
CTTTGTCTCAGTTGTGGTGAAAGAATAAGACTTAGACCTGAAATGAGAATGATCTTTGAA
GTTGACGATTTATCTCAAGCATCACCTGCAACAGTATCTCGTTGCGGTATGGTTTACGCT
AGTCCCAGCACTCTTTCTTGGAAACCTTTAGTATCATCTTGGATTCAATAACTACCAGAG
GAATTACTAGAAAAAACTCAAAAGATATAGCTGTAATGGCTCTTTGATACTCATATTGAC
AACACAATCGAACTCGTGAGAGGAAAAGCTTTTAAAGAACCTATTCCCACTGTTGACAAT
AACTTTGTCATATCTATGTGCAGATTGATGCAGTCAATCCTTGAGCATGTAATCGACATC
AAGAAATATGTAGGAGATAGACAGAAGAAAGCTATCATTAAGATCTTCATTTATTGTTTG
GCTTGGTCATTTGGAGGAAGCATTGATTCATAACATTATTCTTCTTTTGAAGTATACCTA
GGTACTGCCTTCAATATTAGTGATTTACCAAAGACCTCTATTTTTGATAATAAGTTAGTT
TAAGGGGCTGAAATGCTTGAATATGCAACATGGGTTCAAGACCTTCCTAAATTTGAGTAC
TCTTCAGATAAGAGTTTCTTCGAGTTAGTGGTTCCAACAAAGGATACTGTAAGATTCTCA
TGGCTCTTGAAACAAAATATTATCAATGGAAACCCAGTCTTTTTCACTGGAATTACAGGA
GTGGGGAAATCAATAATAGCCAACTCAACCATAGCAGAGATGAAGAAAAAAATGAATTAT
GAAGCTATTATTTTATCTTTCTCGTCTCAAACTTCATCAAAAGAAACTCAAAACTAAATT
GAAGATAAACTCGAAAAGAGAAGAAGAACTCTTCTCGGTGGTCCAAATGGAAAGAAAGTC
ATTCTCTTTATTGATGATGTTAACATGCCCGCTTATGATGACTATGGAACTTAAATGCCT
ATTGAATTACTTAGATAATTCATTGATTTCAAGGGTCTCTATGACAGAGAAGGTTTGTAT
TGGAAAAATATTCAAGATACCACTTTAATTTGCTCAGCCGCTCCTCCTGAAGGTGGTAGA
AAAGTTTTATCAAAGAGATTCACCAGGCATTTCCATATGATCTGTTTACCTCCCACTCAA
GAAGAATCACTTTAAATGATATTCATGTCAATTATAGACGGCTTCTTCACCCCATTCAAA
AAGGATGTCTAAATGCTATCCAAACCTATGGTCGATTCTACTCTTTTGATTTTCAAAAAG
ATCACTGCTTAATTAAGACCAACTCCAGCAAAGAGTCATTACACATTTAACTTGAGAGAT
ATTTCTAAAATATTCTAAGGAGTATGCATGGCTAAGACTCAAACACTGAATCGTAATGAC
AAGATGATTAAGTTATGGATCCATGAGGCATCAAGAGTATTCCATGATCGTTTAGTATCA
TCAGAAGATAAGAAATGGTTCACAGAGTTAGTAGTTGATTTGATTAAAAATGCCTTCAGA
GTAGACTGGACTCATGCAGACCTCTTTGAAAGCAAACCCTTAATCTTTGGAGATTTCATG
AAACGCAGTGTCCCTTATGAAGAGCGTTAATATGATGAAATCAGAGACATCGCATCAATG
AGCACTTGTATCATGGACTATCAAGAAGAGTACAACATTGATCATATGAATAAATTCGAT
TTAGTTCTATTCCCCGAATGTTTGTAACACATCTCTAGAATTTGCAGAATTTTAAGACAA
CCAAGAGGTAATGCTCTTTTAGTAGGAGTCGGTGGTAGTGGAAAATAAACTTTGACTAGA
TTGAGTGCTTTCATTGCAGACTGCGCTTTCTCCACTCTTGAAGTAAAAAAGAATTTCAAT
CAAAATGATTTCAGAGACAACCTTAAGAAGGCAATGTTACCATGTGGAATTAAAGGTGAA
AGAACAACATTCTTAATTAACGATAATTAAATCACAAATGAGAGCTTCCTAGAAGATGTG
AATAATCTATTAAACTCTGGAGAAATTCCCAATCTTTGGCTTCAAGAAGACAAAGATCTA
ATTAATAATGATTTGCGTAAAACTGCAGGTGAAAGAGGAATTTATGAAAACATTTACAAT
TTCTATCTTCAAAGAATGAGAGATAACTTACATATAGTGCTCTGTCTTTCACCTGTAGGA
GAATCTTTCAGAAGTAGAATTAGAATGTTCCCATCTATGGTAAACTGCTGTGCTATTAAC
TGGATTAACGCTTGGCCTGAAGAAGCCTTACTTAGTGTAAGTAGCAGATTCATATCGAAG
ATAGACATAATTAAGGAGCCAGCTCTTAAACACAAAATAGCTTAAATGTGCGTATATGTT
CACTAATCAGTCGAAGAAGAATCACACGTTTTCTATGAATCCCTGAAGCGCAAAGTTTAC
ATCACTCCAAAGAGTTACTTGGATTTGATTAAATCTTATCAATTGTTCTTAGCTGAGAAA
AATCAAGAACTTAGTGTTAGAAGAAACACGTTATTCACTGGTCTGAGTAAACTTCAAGAA
ACTAATAAGGAAGTCAGTAGACTTTCAGAAGAACTGATCACTCTATAGCCAAATCTTGAA
GTCTCAGTTTTAGAAGCAGAGCAGATGTCAAAGAAACTAGAGAAAGATAAGATTGAAGCC
AACAAGAAGAAAATGGTTGTGGAAGAAGAAAAGAGAATAGTTGATAAGAAAGCTGCAGAA
GTAACAGCTCAATATGATATTGCTATGGCTGAGTTATCAGCTGTACTTCCAATTCTTCAA
GAAGCAGAATCTGCTCTAGATACTCTAAATCCTAATGACATCACTGAAATCAAAAGTACC
AAATCACCATCTAAGGGTATCCTAAATACCATGATTATGACCTACATGTTGATAGAAAGG
AAGCACGATTATAAGAAAGTAGAATGGCCTCTCTGCTAAAAAATGATGAGTGTTGGTTTC
TTTGAAAAACTTAAGTCCTACAAAAAAGATGATGTTCCTGAAAGAGTTGTTAAAGCTATG
GATAAGTTTGTCCAAGAAAATCCTGACTTCACTCCAGAGAACGTGAAAAACTCATCCAAG
GCTTGCTATTCACTTTGCAAATGGTGTCTTGCTATTGGTAACTACGCAAAGGTAGCGAAA
GAAATTGAGCCAAAGAAGAAAATGGTGGAAGCTATGGACGCGGAATTAAAGAAAGCCTAA
GCTGAACTACAGTTGAAGGAGAACAAATTGAGAGAAGAGATGAAAAAAGTTGAAGACTTG
GAGAGAGCTTATATTGAAGTCAAAGAGAAGAAAGAGAGATTAGAAAATGAAATTGAATTA
TGTAGATAGAGACTTGGAAGAGCTGAGAAACTTACGAGTGGTCTAGGAAGTGAGCATGAA
AGATGGTAGGAGAATGTACAGATACTAGATAGCAGAATTACACAATTAGTTGGTGATGTC
TTCATCGCAGCAGCTTGTATTTCATATTATGGACCTTTCACTGGAATCTTTAGAGAAAAG
CTGGTGTCAAAATGGGTCGAAGAGTGCTTGTCATAAGAAATACCAACATCAGATAAATTT
AACATGCCACTTGTAATGGGAGATCCTATGGAAATCTAAAACTGGAATATGAACGGTTTA
CCATCAGATTCAGTCTCTATTAGCAATGGTATAATTGTAAAGTATGGAACCAGAAAACCA
CTTATGATTGATCCCTAACAATAAGCCACAAAGTGGATAAGAACAATGTACGCAGATGAA
AACATTGTTAATCAAAAAGATATTGGATAACTTAAAATTACAAGAATGGGTGCAAAAGAT
ATGATAAAGACTATGGAACTTTGTATTAAAAACGGTTATTAGCTTCTTATTGAAGATATG
GGTGAATATACTGAGCCTGCTTTCGAACCAGTCTTGCTTAATTAAACTTTTAAGAGTCCC
CATGGAAGAGAGCAAATAAACTTTGGAGACACAATCATCGATTATGACCAAAGGTTTAAG
CTCTATATGACAACAAAGATGCCCAATCCACATTACTTACCAGAGATGTTTATCAGAGTT
ACAGTTATAAACTTCACAGTTACCTAAGAAGGTCTAGAACAGCAACTTCTAGCTGAGATT
GTTAAACTTGAAAATCCAGCTATTGAAATCAAGAAGCTTGAGCTTACCAGAGCCATTGTT
AATGATTAAAAGAGAATGAAACGTATTGAAGATGAAATCTTGAATTAACTTGTTAATGCA
AGTGACAATATTCTAGACGAAGAGGATCTTATTAACTTCCTAGAAAAGTCAAAGATAACA
AGCGGTGAAATCAAAGTAGCTATGGAAGAGAATGAAGTAGCACAGATTGAAATCGAGGAA
GCTAGATCAAAGTATTAAATAGTTGCTGAAAGAGGATCGATTCTATACTTCGTGATTGCA
GATTTAGCAGGTATTGATCCAATGTATCAATACTCACTATTATACTTTTTAAGGCTTCAC
AATCAAATCATCAGTCAAAGTGAAAAATCAGAAAATTAAGATGAAAGAATTAAGATCTTA
ATGAGAGAATTAACTCAAATAGTTTATAATAACATTTGTAGAGGTCTATTCAATAGCCAC
AAGCTAATATTCTCATTCATGATAGGTACTAGAATTTTATTGCAAGCAAAAAAAATCTCT
ATGTCAGAATGGAATTTATTCTTGAAAGGAGTTATTATGGATGGAGATATTAAAAACATT
AAGAACCCAGAGCCAAATGAAATTACTGAGAAAACATGGAGATTCATTTTGAATTTAGAG
TGCACAAGCTAGGAGTATGAAGGTTTGTCTGATAACATTGTTAAAGAATACAAAGTATGG
AGAGAGTGGTTCCTTTCAAAAGATCCTTAAAATTTACCCCTTCCAGATAAATGGGAGGAA
TGTTTGACAAGGTTCCAAAAACTATTGATCTTTAAGGCTTTCAGAGAAGATAAGCTTGTC
TTCAAGATGAGAGAATTCGTAGAACAAGAATTAGGTAATCAATTTGCATATCCTCTTCCA
GTTATCATGGACGAGGTATTTAAGGACTCTGATAATAAAACTCCAATTATTTACGTTCTA
TCTCCTGGTGCTGAACCAACAGCCTTATTCTTAAGATTTGCCAACAAAATTAGGGGAGAT
AGCCTTGATGCTTATCAAATCATTTCTCTTGGTTAAGGTTAAGACAAATTTGCATTAGAA
TGTATTGAGAAAGGAACGAAAACTGGAACCTGGGTTTTACTTCAGAACTGTCATTTATAC
AAATCATTCATGCCTAGACTTGAGAAAGAAGTCCTTGACATTAACGAAAATGCTGGAAAC
ATCCACCCAGATTTTAGACTGTTCTTAACCTCCATGCCTTGTGACTACTTCCCAGTTTCT
GTTTTACAAAATGGTATTAAAATCACTAATGAGCCACCAAAAGGTATTAAATCAAACATT
ATTGGTAGCTTGACTCAATTGACAGAAGAAAAGATCTCTGGATGTAAGCGTGATATCGAG
TATCGTACATTGCTCTATTCTGTTTGTTTCTTCCATGCAGTCATTTAAGAGAGAAGAAAG
TTCGGGCCTCTAGGATGGAACATCAGATACGAGTTTAACGAAAGTGACTTTGAAACAGCA
ACCACAGTTATGAAGGGTATGTTGAATGAAGAATCAGAGAGCATTGTCTGGAAGGCACTT
TAACAAGTCACAGGAGATATTGTTTACGGAGGAAGAGTCACTGATGATATTGACAGGAGG
ACGCTTATGATGATCCTTACCACTTTCTTATCAGAAGAAGTGCTTTAACCAGATTATAAA
TACTCAAATTCAGGTGTTTACACTCCAGTTTTCCCTGATGATACTTTATTAGAGGGATTA
ATGCGAAAGGCGAAGTCATTGCCAGATGTAGACAACCCAGAGATCTTTGGAATGAATGAT
AACGCTGATATCGCTTTCTAGCTTCAAGAATCACTTAGTATGATTGAGATAGTCTTAAGT
GTATAGCCAAGAACAAGCTCTGCTGCTGGTGGAGGAAAGAGTCCAGATTAGATCATAGAA
GAGTTAGCAAATAAAATTGAGGCTGAGCTACCAGATCTAATAACCAGGGAAGGTGCACAT
AAGGAACTTTTTATTCAAAATAAGGATGGCTTACTACCCTCTTTGACTACTTTCTTGCTT
TAAGAAATGGAAAGGTTCAACAAGCTTGTTACTGTTATTGCTAAATCACTTGATACTCTC
AAGAAGGCATTGAAAGGAGAAGCTGTTATGGGAGAAGACATTGATCGCATGTACAAAAGC
ATGTTGAATAACAAAGTACCAGAAATGTGGGCATTCCATGCTTATCCTTCTTTGAAGCCT
CTTTCAAGTTGGATCGAAAACTTGCAACAAAGAATAGAATTCCTCAAGATGTGGCTTCTA
AAGGGTAAATTAGCAGCATATTGGTTACCAGCATTCTTCTTCCCCTAAGGGTTCTTGACA
GCTCTTCTATAAAACTATGCAAGAAAGTACTCGATTGCTATCGATGCTCTTAACTTTGGA
TTCCAGTTCCAGACATTCTATAAGATAGAGGATGTAGATACTCACCCAGGAGATGGTGTA
TTCTTCTATGGATTCTTTATGGAAAGTGGAGAGATTAATTCTAGCACTCTACTTTTAGAT
GATGCTGCAGCTGGTCAGAAGTATTCTGTTGTCCCCATGATCCAATTCAGGCCTGAAAAA
GACCACAAGATGAATGAGAAAGATTTCTTATGCCCAATGTTTAAGACCACTGAGAGAGCA
GGTACTCTTTCAACCACTGGTCATTCAACTAACTTCGTTATTATGGTGGAAGTTCCCTCA
AGAAAGGTACCTAAGCACTGGATACTCAGAGGTACTGCGCTTTTCTGTCAACTTGACGAT
TGA


>Contig2564.0.g105(protein)
MEQKKKDLHSQSVRDLTQSQFVMNRDASDLQQKLLAQRLYAKYSDTGHIIPNKLVGPPMP
SGSSILGSHRRSLQIDDSVLSLNKKSASLARFKRPEELMSPDAQEVRKNSQMRAKLPKIQ
SRKHIDISQTPLPTLPFPRVLGKDIISPFPGSQDHLALKRIIAQHQAQASILADSQNLTA
STSQQILNSYRNGAQGSGFLAQSQSQLTLKTALQNPTHNQTLLHNQSTLSLISPNDKTLA
ILESHQRRNNRTSLTHHQSFQQLLPIDNSKILNSTLEAHGQHHNGTHDQTQTNASALILR
NVPLPNYEQTKQIMTFDPAKIKPKPTSDIKKIMVRQGMKPTPLEFIKLVQLDPDFQNRFC
YCNKKEDFYEFEIVPFSDKNEAEYMTVSQRGVVHFIKGEANFMSIPEWEREQRIYKNIQK
IPFFLKYRTWKTFSAWKTLMRRTMIFKTSDFLNRELFILDSELSKPLLDIRMKTFNIQKM
QMVAMNTEKPRNMQEFFEHQDKQRKTVNESLNKIEKEIKNILIDSCDSSMRTFREENRIS
LNDNQEDDDNEEAEPFLVGDETHKQMPYTQEATTRTHYKKLAKYIRLTDYMIIDSKLRLI
QYSITNVLKIVQLDFKLPRKFLIGDKIQQVPLFEITIDFQGFDLYFNPNKFDVRDAIKNS
ITEGVNSVCRYELFINQPEFETYINVQEQEDHLFDEQNDLMSLAIGSDMLIRDTELISQA
IDGVFDDMKEEVKEYDQFVQIYNENITTTAEDFRQRDHDFMNQKIKQLENQQEEIDRLDV
RKTIKVVRLDGEKMKKRIRESPKQVWKMLQDFIPKFQFEKLDALCETLKLEFSKIANKPQ
SIDQFVVIMKDLNDLSGRIDNFASMFQEIEEYNILMDEHKIKLPDKNKSKFKETQSLLIK
TRKQMEEGLEAGEVEELKFKKQLIDTEIPKLNKQSKAILDELTNVMFSDSKTQIMDAVRK
LEEIGESVTQMKERGKQLNTYQKFLELEDTPFESVNDAFNDWNLKYKLWKGLDEWIYLSR
DWVNTKFTAIDVEDIQKQVDKFFSSASVCYINMKENPVTQIFKEKVDVLKSTMPVVSYLR
SDLQERHWIEIYDILGMTLDLNNDDFTLNSLIELNVKQEKDKIGEIAQKAEKEKELEATY
EKVAAEWRKAIFETKQHKDAYFILGSTEDVNNLLEESMVTLSNVLGARFVDIIRELVEQL
YKKLQYLENLLNEWQTFQRTWMYLENIFNGSDIAQKMGQDAKKFQTVDAQWKDIMKSTHG
NPGVKRFIDNNYKDGQPYLDLFKNNNKILDDIQKSLEVLLEKKRSEFSRFYFLSNDELLS
ILAEASRDPECVQAHLRKLFENINRITFEYDEITKIISAEKEVIKIKKVKTGGNQPVEKW
LLQLQDNMMGAVKKFIKDAHYAYKEDEEFKRHQWVMEDHPAQAVCVVASINWCGATENLL
KDEDEVSEGLAWWYSENVKQLEELTKIVSRSDIDSRKRKAVVALITQDVHYRDIVEELIK
EEVENPHDFKWQQQLRYYYSNEEIAIKQVNAQLDYGYEYLGAHTRLVITPLTDRCWMTIT
GSLHIKLGAAPAGPAGTGKTESTKDLAKGLGKYCVVFNCSDQINYKMMEQLFSGLASTGS
WACLDEFNRIDIEVLSVIAQQILTIRNAMLQQRTEFQLGDRYIGHFVDTMGIFITMNPGY
KGRTELPDNLKVLFRPVSMMIPDYALIAEIMLFAEGFVQAKPLSRKMTKLYKLASEQLSQ
QAHYDFGMRAVKSVLVMAGQVKRNNPKMPEDIVLIRAMRDSNIPKFIKEDLPLFNAIVKD
LFPGTQLPESQYDMLIQAINDTQSQSGLTSDPYQIEKIIQFYETMNVRFGLMIIGQTLTG
KTTIIKSLKQAMNQMRKNGYTGEDYLAVESETLNPKSISLDELYGSFSHLTQEWTDGLAS
QLIRGFVEKTHNDMKWVIFDGPVDAIWIENMNTVLDDNMTLCLSCGERIRLRPEMRMIFE
VDDLSQASPATVSRCGMVYASPSTLSWKPLVSSWIQQLPEELLEKTQKIQLQWLFDTHID
NTIELVRGKAFKEPIPTVDNNFVISMCRLMQSILEHVIDIKKYVGDRQKKAIIKIFIYCL
AWSFGGSIDSQHYSSFEVYLGTAFNISDLPKTSIFDNKLVQGAEMLEYATWVQDLPKFEY
SSDKSFFELVVPTKDTVRFSWLLKQNIINGNPVFFTGITGVGKSIIANSTIAEMKKKMNY
EAIILSFSSQTSSKETQNQIEDKLEKRRRTLLGGPNGKKVILFIDDVNMPAYDDYGTQMP
IELLRQFIDFKGLYDREGLYWKNIQDTTLICSAAPPEGGRKVLSKRFTRHFHMICLPPTQ
EESLQMIFMSIIDGFFTPFKKDVQMLSKPMVDSTLLIFKKITAQLRPTPAKSHYTFNLRD
ISKIFQGVCMAKTQTLNRNDKMIKLWIHEASRVFHDRLVSSEDKKWFTELVVDLIKNAFR
VDWTHADLFESKPLIFGDFMKRSVPYEERQYDEIRDIASMSTCIMDYQEEYNIDHMNKFD
LVLFPECLQHISRICRILRQPRGNALLVGVGGSGKQTLTRLSAFIADCAFSTLEVKKNFN
QNDFRDNLKKAMLPCGIKGERTTFLINDNQITNESFLEDVNNLLNSGEIPNLWLQEDKDL
INNDLRKTAGERGIYENIYNFYLQRMRDNLHIVLCLSPVGESFRSRIRMFPSMVNCCAIN
WINAWPEEALLSVSSRFISKIDIIKEPALKHKIAQMCVYVHQSVEEESHVFYESLKRKVY
ITPKSYLDLIKSYQLFLAEKNQELSVRRNTLFTGLSKLQETNKEVSRLSEELITLQPNLE
VSVLEAEQMSKKLEKDKIEANKKKMVVEEEKRIVDKKAAEVTAQYDIAMAELSAVLPILQ
EAESALDTLNPNDITEIKSTKSPSKGILNTMIMTYMLIERKHDYKKVEWPLCQKMMSVGF
FEKLKSYKKDDVPERVVKAMDKFVQENPDFTPENVKNSSKACYSLCKWCLAIGNYAKVAK
EIEPKKKMVEAMDAELKKAQAELQLKENKLREEMKKVEDLERAYIEVKEKKERLENEIEL
CRQRLGRAEKLTSGLGSEHERWQENVQILDSRITQLVGDVFIAAACISYYGPFTGIFREK
LVSKWVEECLSQEIPTSDKFNMPLVMGDPMEIQNWNMNGLPSDSVSISNGIIVKYGTRKP
LMIDPQQQATKWIRTMYADENIVNQKDIGQLKITRMGAKDMIKTMELCIKNGYQLLIEDM
GEYTEPAFEPVLLNQTFKSPHGREQINFGDTIIDYDQRFKLYMTTKMPNPHYLPEMFIRV
TVINFTVTQEGLEQQLLAEIVKLENPAIEIKKLELTRAIVNDQKRMKRIEDEILNQLVNA
SDNILDEEDLINFLEKSKITSGEIKVAMEENEVAQIEIEEARSKYQIVAERGSILYFVIA
DLAGIDPMYQYSLLYFLRLHNQIISQSEKSENQDERIKILMRELTQIVYNNICRGLFNSH
KLIFSFMIGTRILLQAKKISMSEWNLFLKGVIMDGDIKNIKNPEPNEITEKTWRFILNLE
CTSQEYEGLSDNIVKEYKVWREWFLSKDPQNLPLPDKWEECLTRFQKLLIFKAFREDKLV
FKMREFVEQELGNQFAYPLPVIMDEVFKDSDNKTPIIYVLSPGAEPTALFLRFANKIRGD
SLDAYQIISLGQGQDKFALECIEKGTKTGTWVLLQNCHLYKSFMPRLEKEVLDINENAGN
IHPDFRLFLTSMPCDYFPVSVLQNGIKITNEPPKGIKSNIIGSLTQLTEEKISGCKRDIE
YRTLLYSVCFFHAVIQERRKFGPLGWNIRYEFNESDFETATTVMKGMLNEESESIVWKAL
QQVTGDIVYGGRVTDDIDRRTLMMILTTFLSEEVLQPDYKYSNSGVYTPVFPDDTLLEGL
MRKAKSLPDVDNPEIFGMNDNADIAFQLQESLSMIEIVLSVQPRTSSAAGGGKSPDQIIE
ELANKIEAELPDLITREGAHKELFIQNKDGLLPSLTTFLLQEMERFNKLVTVIAKSLDTL
KKALKGEAVMGEDIDRMYKSMLNNKVPEMWAFHAYPSLKPLSSWIENLQQRIEFLKMWLL
KGKLAAYWLPAFFFPQGFLTALLQNYARKYSIAIDALNFGFQFQTFYKIEDVDTHPGDGV
FFYGFFMESGEINSSTLLLDDAAAGQKYSVVPMIQFRPEKDHKMNEKDFLCPMFKTTERA
GTLSTTGHSTNFVIMVEVPSRKVPKHWILRGTALFCQLDD