Identifiers and Description

Gene Model Identifier

Contig254.1.g19

Standard Name

None

Aliases

Contig254_1_g19

Description

RING-H2 zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam12678 ) RING-H2 zinc finger
  • ( pfam12861 ) Anaphase-promoting complex subunit 11 RING-H2 finger
  • ( pfam13639 ) Ring finger domain
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13901 ) Domain of unknown function (DUF4206)
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam13771 ) PHD-like zinc-binding domain
  • ( pfam11793 ) FANCL C-terminal domain
  • ( pfam05883 ) Baculovirus U-box/Ring-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL133W3.999458587140588e-43HRT1 SGDID:S000005493, Chr XV
from 70325-70690, Genome ...
T. thermophilaTTHERM_003137104.999723464643358e-28RING finger protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig254.1.g19(coding)
ATGGTTGACACTCTCCCTCAAAAAAGATTTGAGATCAAGAAATGGAATGCTGTTGCACTT
TGGGCTTGGGATATCCACGTTGACAACTGTGCCATTTGCAGAAACCATATCATGGATCCT
TGCATTGAATGTCAGGCAAATCAAGTGGTGAACGCAAATGAAGAATGTACTGTGACATGG
GGTGTCTGCAATCACGCCTTCCACTTCCATTGCATTTCAAGATGGCTCAAAACTCGTCAA
GTCTGTCCTCTTGATAACAGAGATTGGGAGTTCCAAAAGTATGGTAAATGA


>Contig254.1.g19(protein)
MVDTLPQKRFEIKKWNAVALWAWDIHVDNCAICRNHIMDPCIECQANQVVNANEECTVTW
GVCNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGK