Identifiers and Description

Gene Model Identifier

Contig250.0.g16

Standard Name

None

Aliases

Contig250_0_g16

Description

ABC transporter

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002195309.997093137033517e-262ABC transporter family protein
SGDYGR281W2.999784173812224e-165YOR1 SGDID:S000003513, Chr VII
from 1052824-1057257, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig250.0.g16(coding)
ATGGACGTAGCAGACTCAGATAAACCACTTTTACAAGCTAATTATTCAAATAATAATAAC
TTATATACATAAGATTAAAAATAAACAAATCAAGAGAATGAAAAATCACATCATCATGAA
CAATAAAAAGTAGAATTTTAACCAAGAAATATAAATACTGAAAATATTGAGCCAACAATG
CATAAAAAGTTATTCAAAGGAAATATTGCTATTGACGCAGTTCCATTATTCAAAAGATTT
ATATTCAGCTGGGCTTACCCTTTTGAATCACATAAAAATGGCTTGAGTTATGAATAGTAC
GGTGACTTAAGAGAAAATGATAAAATTGAGACATAATAACTAAAGATCAGAAGGAGTTGG
GATATGTATAAGACGACGAAAAGCTAAAACGCTCTTATCAAGGCAGTTCTTCATGCCTAT
AGATATGACTATCTTTTCGCACTATTTCTCAATGTCATAGGGGGTGCTTGTGAATTTGCA
GCGCCTTTCCTAATTAACTTAATAATCTCTTATATCGAGACACCAGATGAAGAAGTTTAT
TGGGGTATTATATATGTAGCAGCATTAATAGTAACTCAAGCTATTAACTATTTGTTCTTT
GAACATATCATTTATCAGCAAGTTATGATTGGTGTCTAAAGTGTTAACTCCCTTGTCGTT
TTAATCTATGAGAAGTTATTTTAAATATCACCAGCGACTAACAAATAGTTCTCACAGGGA
GAAATAGTAAACTTCATTTAAGTAGATGCCGAAGTGCTATTTATGATAAGTTTTGACATG
CCTACTATGATTAAATTTCCAATTATTCTATTAACCTCCATAGGATTCTTGTTCTACTAT
TTAGGTCTGAGTTTCTTCGCTGGAATTGGAGTCATAGTAGTAGGGTTCGTAACAAACCTC
ATACTTGGCTTGATCAATGCCTCGCTATGGAAGGGCTTAATGACCAAGAAAGATAAAAGA
ATGAATGCAACAACTGAAACCCTATAAAGCATAAAGATGATCAAACTCTATGGGTGGAAT
GATACATTTTTACAAAGAATCAATCAGAAGAGAGATAATGAACTCAAAAGCTTGAGGAAA
GCTTTCTTCTTTACTTGTCTAATTATAGCTTGCATGTACCTTTTTCCACAATTATTAAGT
CCTGTGGTATTTACTACTTACATTGGTTCAGGCCATAAAATAGATATCAAAACAACTTAC
ACGATTATAATATTCTTCAACATGATAAAGGAACCTCTAAGATTTGTGCCAGAGTTCTTT
GGTGAATTAGTAGAGACCCTTGTGTCAATGAAAAGAGTGTAGAAATTCCTATAAAGTGAT
AATGTAAACACTACAATTATTAAACATTCCCAAGAAAATTAAAGTGAAAACTCTATTGTA
ATTAAAAACGGTAACTTTTCTTGGGGATTTCCTTTTAAGAAGGAAAAAGAAGATGAAGAT
GATAAATAATCTACAAGTTTTGAAGATTTAGATCAAGAAGTAAAAAAGTAAAAGAAGAAA
AGTTTTAAGAAAAAAAGTAAAAAGAGCTAGAGCAAAGTTGATAATGATTAAACTTAGCTA
TTATTAGATTCACATTAACAAGAACAATCATTAATACTTGAGGAAGACAGAGAAATTGAA
AAAAATCTAAAGAAGGGAGTTATAGAACAGGAATAGAATAAATCTTAAAAAGAGAAGAAA
GAGGAAGAAGTTAAGGTATCAAAGAAAGTTTAAGATTTAATTACATTAAAGAACATAGAT
TTGTAAATTAGGAAGGGAGAATTTGTTACAATCATTGGAGATGTTGGTTCAGGCAAGAGT
AGCTTACTCTCCGCACTAATAGGAGATATGCTTTATTTCGATTAAGAGACCATCCACAAA
TATGGGGGCTTAGAAGGTGAAATAAATGAGTAACTGTTAAATCAAATGAAGTATGATGTT
CTTACTAAGGATCACTAAGATCCCCCTATAATTATCGAAGGATCCACTTCCTATGTTTAA
CAATAACCCTGGATCTAAAACATGACAATAAGAGACAATATTCTTTTTGGTATACCATAT
GATGAACAAAAGTATAGAGAAGTTATAAAAGATTGCGAATTAGAAAGAGATCTAGAAATC
TTACCTGCTGGAGACTATACTGAGATCGGAGAAAAAGGTATAAATTTATCAGGAGGTCAA
AAAGCAAGAGTATCTCTTGCAAGAGCAGTTTATCAAAACAAAGAAATAGTGCTGATGGAC
GATCCAATTTCTGCACTGGATGCTAATGTGAGAAAACAGATCTTTTAAAATGTCATCATG
AAACAGTTCTTGGGCAAAACAAGAATACTGGTAACTCATGCAATTGACTTTCTTAAAATG
ACTGACAGAATCATAATTATGAAAAACGGAGAGATAGTAGCTATGGGGTCGTATCAAGAA
TTAGAGAATAATGAACATTTAATTGAGACAATTAAAATTCATTAAAAGAACACGTAAAAC
TAAAATGAAGAAAACAAATAGAATGAACTTGAGAATGCAATAATAGACAGATCCTTAATG
GATTCAGAGATTGCTTATAATCCCAGAGCAAATATTTAAACTATAATAACAGATGATAAT
AGGTAGACTTTAATGAGTTAACAACCCTAATTCTAATCTCATATAGAAATTTAACATGAA
GATCATTCACAAAATAAATAATTTTAAGAAGTAAAAGTTTCTGATGAGGAGAAACTAAAA
AGAATTAAAGAGGGTAAAATATTAGAAGACGAAGAAAAAGAAGTCATCAGAGTTGAACCA
TAATCTTACAAGCTTTTGCTTGAATTGGCAGGAGGATGGAAACTACTCACTTTAGTTAAT
GTAGCAATGATTTTATTTGTTGGCTCTCAAATTTATGCTGATTATTTGCTTGGTTAGTGG
TCTGACAGTCTAGGAAAAGATGAAGACAATTTCTACTTTTACACTTACATGATCTTTGGA
ATGAGCATATTGTAAGGTTTAATGGCATTCGTTAGAACTTTAAGCATGCAATTTTTCTCT
TTAGCAGCATCAAGATCCCTACATTAGAAGATGATTGCTAGAATCCTCAAGGCTCCGATA
AACCTATTCTTCGATGTCACACCTATAGGTAGAATTCTTAACAGATTCTCAAAAGACTTA
ACTGTCGTAGATACTGAAATAGCATTTACTATGAGTACAGCTGTAGTATGCTTTTATGGG
GTAATAGGAACTTTAATAGTGGCATCAGTTGCTGTTTATTGGATCATTATTCCCATACCT
GAAACTGTGGCTGGCATATCAACTATTAGATCATTCCAAATCAGAGAAGACTTTGTGAAA
AGAAACTATTAACTTCTAAATAAGAACATTCTCGCAAATTAAATTGCAGTTGCTCTTGGA
GCTTGGATATCTATTAGATTAGACATAGTTTCAATATTGTTCATGGCTCTTGCTTGCTCA
TTTTGTATAATTTTTAAAGAACAAAGTAACCCCGTGATGCTTGGCATGCTTTTGACATAT
ATTTTGAATTTAACTGATTCTCTTCTGTACTTACTCTACCTAGTAGGACAATCCGAAAGG
AAAATGGTATCAGTGCAGAGATGCTTCAAAATACTAGAGGTCCCATAAGAAAACTTCGTA
AATGAAGATAATACGAAGAAATTTAAGGAGATAAATAAAGATTGGCCAAGAACAAGCTAG
ATTGAATTTAAAGATGTCGTTCTACGGTACAGGCCGACTACTGAAGTAGTTTTGAACAAA
CTTTCATTCACAGTTAAACCAGGTGAGAAAATTGGAGTAGTGGGAAGAACAGGAGCTGGT
AAATCAACAATCTCCCTTGCATTGACAAGAATAGTGGAATTAATTTAAGGCTAAATATTG
ATAGATGGTTTAGACATTAAAGATGTCCCACTAGATTACCTAAGGCAGAAAATTACAATT
ATCCCCCAAGACCCCACTATGTTTAATGAAACTTTGAGATTTAATTTAGATCCAATGAAT
GAAAATACTGATGAAAGGATAATGCAAGTGCTTAGTGAAGCAAATTTGGACACTCTAGTG
TCAAGAGACAAGAATGGATTAAAAATGCGAATTACTGAGAATGGTGGAAACTTAAGCAGT
GGAGAGAAGCAACTTATCTGTATTTGTAGAGCCATCTTAAGAAAGAATAAAATCGTGCTG
TTAGACGAAGCCACCGCAAATATCGACATAGTCACTGAATAGAGCATTCAGAAACTTATT
AACTTAGAATTCAAGGATGCTGCAGTTATCACTATAGCTCATAGATTAAACACAATCATC
AAATCTGACAGAGTTCTTGTATTATCATTTGGATAACTATTAGAGTATGATACTCCATAA
AACCTTATGAATGATGAAAGTACAGAGTTTTACAAGCTGTTGCAAGAGCTTAAGAAAGAA
GAGCAAGAAAATCATAAATGA


>Contig250.0.g16(protein)
MDVADSDKPLLQANYSNNNNLYTQDQKQTNQENEKSHHHEQQKVEFQPRNINTENIEPTM
HKKLFKGNIAIDAVPLFKRFIFSWAYPFESHKNGLSYEQYGDLRENDKIETQQLKIRRSW
DMYKTTKSQNALIKAVLHAYRYDYLFALFLNVIGGACEFAAPFLINLIISYIETPDEEVY
WGIIYVAALIVTQAINYLFFEHIIYQQVMIGVQSVNSLVVLIYEKLFQISPATNKQFSQG
EIVNFIQVDAEVLFMISFDMPTMIKFPIILLTSIGFLFYYLGLSFFAGIGVIVVGFVTNL
ILGLINASLWKGLMTKKDKRMNATTETLQSIKMIKLYGWNDTFLQRINQKRDNELKSLRK
AFFFTCLIIACMYLFPQLLSPVVFTTYIGSGHKIDIKTTYTIIIFFNMIKEPLRFVPEFF
GELVETLVSMKRVQKFLQSDNVNTTIIKHSQENQSENSIVIKNGNFSWGFPFKKEKEDED
DKQSTSFEDLDQEVKKQKKKSFKKKSKKSQSKVDNDQTQLLLDSHQQEQSLILEEDREIE
KNLKKGVIEQEQNKSQKEKKEEEVKVSKKVQDLITLKNIDLQIRKGEFVTIIGDVGSGKS
SLLSALIGDMLYFDQETIHKYGGLEGEINEQLLNQMKYDVLTKDHQDPPIIIEGSTSYVQ
QQPWIQNMTIRDNILFGIPYDEQKYREVIKDCELERDLEILPAGDYTEIGEKGINLSGGQ
KARVSLARAVYQNKEIVLMDDPISALDANVRKQIFQNVIMKQFLGKTRILVTHAIDFLKM
TDRIIIMKNGEIVAMGSYQELENNEHLIETIKIHQKNTQNQNEENKQNELENAIIDRSLM
DSEIAYNPRANIQTIITDDNRQTLMSQQPQFQSHIEIQHEDHSQNKQFQEVKVSDEEKLK
RIKEGKILEDEEKEVIRVEPQSYKLLLELAGGWKLLTLVNVAMILFVGSQIYADYLLGQW
SDSLGKDEDNFYFYTYMIFGMSILQGLMAFVRTLSMQFFSLAASRSLHQKMIARILKAPI
NLFFDVTPIGRILNRFSKDLTVVDTEIAFTMSTAVVCFYGVIGTLIVASVAVYWIIIPIP
ETVAGISTIRSFQIREDFVKRNYQLLNKNILANQIAVALGAWISIRLDIVSILFMALACS
FCIIFKEQSNPVMLGMLLTYILNLTDSLLYLLYLVGQSERKMVSVQRCFKILEVPQENFV
NEDNTKKFKEINKDWPRTSQIEFKDVVLRYRPTTEVVLNKLSFTVKPGEKIGVVGRTGAG
KSTISLALTRIVELIQGQILIDGLDIKDVPLDYLRQKITIIPQDPTMFNETLRFNLDPMN
ENTDERIMQVLSEANLDTLVSRDKNGLKMRITENGGNLSSGEKQLICICRAILRKNKIVL
LDEATANIDIVTEQSIQKLINLEFKDAAVITIAHRLNTIIKSDRVLVLSFGQLLEYDTPQ
NLMNDESTEFYKLLQELKKEEQENHK