Identifiers and Description

Gene Model Identifier

Contig2324.0.g3

Standard Name

None

Aliases

Contig2324_0_g3

Description

Fructose-1-6-bisphosphatase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008255407.999607936310296e-81fructose-1,6-bisphosphatase fa
mily protein
SGDYLR377C1.0002124404074584e-26FBP1 SGDID:S000004369, Chr XII
from 874792-873746, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2324.0.g3(coding)
ATGGAAGGAATCTACGCCCACGCCGATTTTATAAAAGTATACAAAGCTATCCTTGATTCA
ACTCAAGAAATCGCTACCTACCTCAGATATCACTCAGCTCATGTATTGGTTTAGTAAAAC
CAGTTCGGAAAACAATAGTCAGATTTAGATCTAGTTGCAGATGACATCATTTTCAATCAC
TTAAAGAAGAGTGGAGTTGTGCACAGCGCTGCTTCAGAAGAAAAGCCCTTCTTGAATGAG
TTGAATCCTGATGGAGAATATACCGTGACGTTTGACCCAATCGATGGAAGTCAAGTTATT
GATTCAAACTTCGCAGTTGCTTCTGTATTTGCTATTTGGAAGTCAAAGGACATCAACGGA
CTCACTGGAAGAGATTTGGTTGGTGCTGCACTCTCAATTTACGGTTCAAGAACAACCATT
ATTCTCTACAACGCTTAAAATAAGAAGGTAGAGGAGCTCACTCTTCTTCAAATGGGCAAG
AACGAACGCTGGATCGTAACAACTCCAGATCTCAAAATTGAACCTGACGCCAAGCTATTC
GCTCCAGCTCTGAAATCTTCATATGACAACCCTAATTACCTCAAAATCTTCGAGAACTAT
TGCTTGAAAGGCTATTCAATCAGATATTCAGGGGCATTCGCAGTAGATTGTTATCAAATA
TTCATCAAGCGTCAAGGAATCTATTCCATGTTAGACTCTGTGGCTCACCCATCCAGATTA
CATCTCATCTATGAAATTATTCCCTTAGCTTTTCTTATTGAAAAGGCTGGAGGAAAGACA
AGCGATGGAGAACGCAGCGTTCTTGACGTTGAGATCAAAGGGTTCAAGCAGAGAATCTCA
TTTATTGCAGGCAGCTCGAACGAAGTTGATTACATCGTGAGAACATTAAACGAGAAAGAA
TGA


>Contig2324.0.g3(protein)
MEGIYAHADFIKVYKAILDSTQEIATYLRYHSAHVLVQQNQFGKQQSDLDLVADDIIFNH
LKKSGVVHSAASEEKPFLNELNPDGEYTVTFDPIDGSQVIDSNFAVASVFAIWKSKDING
LTGRDLVGAALSIYGSRTTIILYNAQNKKVEELTLLQMGKNERWIVTTPDLKIEPDAKLF
APALKSSYDNPNYLKIFENYCLKGYSIRYSGAFAVDCYQIFIKRQGIYSMLDSVAHPSRL
HLIYEIIPLAFLIEKAGGKTSDGERSVLDVEIKGFKQRISFIAGSSNEVDYIVRTLNEKE