Identifiers and Description

Gene Model Identifier

Contig22850.0.g16

Standard Name

None

Aliases

Contig22850_0_g16

Description

ALG6, ALG8 glycosyltransferase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • transferase activity, transferring hexosyl groups (IEA) | GO:0016758

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005008102.0001503375893664e-79ALG6, ALG8 glycosyltransferase
family protein
SGDYOR002W1.0002758036576784e-62ALG6 SGDID:S000005528, Chr XV
from 329417-331051, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22850.0.g16(coding)
ATGAAAAAGTTATTAGAAAAGTAAAATAACCCTCTGGAGGAAACCACAATATATGATTAG
ACGAAGCCAATTAGCAATTAAGTCACAGTAAGAACACAATAAAATGATAAAAATAATTAG
CAATTACATGTATTAATTGAGAAACATATTGCATCTTCTTCTAAGTAGAAGTACTTGATA
GTAGTATTTGCAATATTGATAAGAGCATGCGTGTCTTTAACTCCTTATTCCGGGGAGAAC
AACCCACCTAACTTCGGTGATTTTGAATGTCACAGAACCTGGATGGAAGTCACCTTTAAT
CTTCCGGTTAATTAGTGGTACAATGATACTGCATATAGTAATAGTAGTTACTGGCCAATA
GACTATCCTCCACTTTGTGCATACACTCATTATGCTATGGCTTAAGTAGTTTACTATTTC
GAGCCAAATGCTCTTCAATTAGGTAAATCACATGGGTATAACAATGGGTAATTCAGAACT
ATAATGCGAACTTTAATGATAATTTTGGAATTTATTGTATTTGTTCCTGCTCTCCACGCT
TTCCTTAACTTTTACTATAAAGACACACCTAAAACTTAAAGGAATGTATACTTTTTGGTA
ATTCTAATGCTTCCTTCTCAAATTTACATAGACCACGGCCACTTCCAACCTAATTAAGTG
ATGCATGGATTAGTAATTTGGGCGATATATTGCATGATGAAAAAACAAATAGCTTTAGCT
GTAGTTTTTATGGTTTTAGCAGTTCAATTTAAATAAATGGCTTTGTATTTTGGATTACCA
TTTGCAGTCTATGCTTTACTTCTTATACTTAAAGATGCTAAAGGGACATTTATATAGAAA
GTTACATAGATATCAGGAAGAATAATAGTCCTAGTAATTGTGTTTATATTAACAAATCTA
GTAATATTCTTGCCATTCATACAAAATTCCGGCATTTAAGGTATGCTCTAGGTTTTAATC
CGCATTTTTCCTGTTAAGAGAGGTCTTTTTGAGAATAATGTGGCTTCATTCTGGTGTGTG
TTGCATAATATTTACAAAGTTAAGAGTATATATCCTTAAGAAACTTAACTTAAATTAGCT
TTGTCTGCTACTGTTCTTGGATGCATCCCTTCCATATATTATATCTGTAGAACTCCTAAC
AATAAATAATTCCTCCTTGCTCTCTTCAATGTCTCGATGAGTTTCTTTATGTTTAGTTTC
CATGTACATGAGAAGCAAATCTTACTACCGATGCTTTGTTTCGCTTTAAGTATTGAAGAA
TTTAAAGGTTTCTATGCTTTAATGATAACTTATTGCAGCTTCAGCATGTGTAAACTATAC
GGTATGGACAACAATTACATGGCTTATCCTCCACTGACAATCGGCTTTTTCTACTTTATC
AAGAAACTAGAGTCAATTATGCTCAATAACAATAGTTTAAGTGAAAACAACTCAAAACTT
ATATTTGATGATTAATTTCAAGTAATAAGAAAACGTGATTTATAATAACATAATCAAGAT
TACAAATAAAACATTAATTAAATTTAATGCAAAACATGGTTGCGTGAATATATACTTAAT
TTGAGAAACTACATATGCACTGTGGCTATTCTAGCTATACTTGCATTTCACATAATAATG
CCCATCTTCCCTCCACCACCCAGACTATTTGATTTATATTGGGCTATCAATAACGCTATG
TCTTTTGGTGTATTCGCATTTATTAGTTTATACGCGCATTTACTTATGCATGAGAACAAC
AATACCGATAGCAGATAAGTCGTTGAGGGAGCACATAAAGTCAAAAAATCTCAATGA


>Contig22850.0.g16(protein)
MKKLLEKQNNPLEETTIYDQTKPISNQVTVRTQQNDKNNQQLHVLIEKHIASSSKQKYLI
VVFAILIRACVSLTPYSGENNPPNFGDFECHRTWMEVTFNLPVNQWYNDTAYSNSSYWPI
DYPPLCAYTHYAMAQVVYYFEPNALQLGKSHGYNNGQFRTIMRTLMIILEFIVFVPALHA
FLNFYYKDTPKTQRNVYFLVILMLPSQIYIDHGHFQPNQVMHGLVIWAIYCMMKKQIALA
VVFMVLAVQFKQMALYFGLPFAVYALLLILKDAKGTFIQKVTQISGRIIVLVIVFILTNL
VIFLPFIQNSGIQGMLQVLIRIFPVKRGLFENNVASFWCVLHNIYKVKSIYPQETQLKLA
LSATVLGCIPSIYYICRTPNNKQFLLALFNVSMSFFMFSFHVHEKQILLPMLCFALSIEE
FKGFYALMITYCSFSMCKLYGMDNNYMAYPPLTIGFFYFIKKLESIMLNNNSLSENNSKL
IFDDQFQVIRKRDLQQHNQDYKQNINQIQCKTWLREYILNLRNYICTVAILAILAFHIIM
PIFPPPPRLFDLYWAINNAMSFGVFAFISLYAHLLMHENNNTDSRQVVEGAHKVKKSQ