Identifiers and Description

Gene Model Identifier

Contig22798.0.g85

Standard Name

None

Aliases

Contig22798_0_g85

Description

RNA polymerase I specific transcription initiation factor RRN3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam05327 ) RNA polymerase I specific transcription initiation factor RRN3

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004389100.000000005997038937208364hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22798.0.g85(coding)
ATGGATCTCAATAAGAATATTCTTAATCCAACTAACTATTTTCAAACTCCCTTACCTTTA
AATCCTAATCGCCATCTTCCCCAGCGACCTTTGCTTATCAAGCATAGTGAGGAGGAAGTC
CTTCAAAGTTTCAAAATCAAAAGGAATGCGTTAATGGAGGCACTTCAATCAAAAAAAGAG
GGAAAGCTTAAAAACTACTATCAAATCATAAACAGGCAAGGATTCGTGAATGCAAAGGAG
GACTCGTAGGCTTTGAGAATATGGGTGAAAGTATTTCTAGAAACGATAACTAATATTATT
CATGATTATTAAGACTCTGAGCTTTTGGAGCTCATTGTTTTTAAACTTCCGTGGTTCACT
CCCACGACTACTCACGGCTAGAACTTTAATAGTTTTATGCGATTATGTCTAGCTATTTTC
CCTCACGATGTATCCTACATTCATAAAGTCATCAAACACATTTTCTCTCCTCATGGATTA
TTCCAATGCGTAATGCTCGGAGAGCATCGGCCAGCTCTTGCTGATCTTCTGTGGGAAAGA
GCACAACTAATCATCAAGAGTTTTGAAATGGCTGATGAGAGTACGGGATCAAATTCAGGG
ATGCAGGCTCAGCTTACACCATAAACCTAAGATTCAGTTTAGATAGACACAAGAACAGAA
ATGAAGAATGACAAAAGTGAAATTGCAACTGAAAATGAATTTCAACCAAGATTAAACAGA
ATCGTGGACCAAGAGCAAATTGCAATTTTTTAAAGAATTCTAAAGGAATAAAAATCGTCA
GAAGATATTTTGGCCAGAGCTAAGTCGATACTCAGAAACCTTTCTGATCAAAATTAAAAT
TAACTTGTCCAAGTAACTGATCTCAATGATTAATTATTTTTAAGAGTCTTATTTAGCTTC
CACCCAAACAGAGAACTGCCCTCTGATTACAAATATCCTATTTTTGTCGGAAAATGCTAA
GGATATCCTACATTCTTTGTGAATTCAAACTTGACAAGTGAAACATACATTCCAGAAGAT
GACGACGCAATATCCGTTAAGAAATGCCTCAGTAAAATCGTATAAGCTTACTCTTTAAGC
TTAAAGATTTTTGCAGAAAAGAAATTCAACACATCAACTTTGAAAAAGCTAGGGATATTC
TTTTCAAAAGTAATGAATTTATATCCATTTGCTCACTAGTTTATTTTGCAAAATCTACTT
GAAAAATTGCCTCACAAAAGCATGCCAATAGAAAACTAGTACCTATATTACAGAATGGTT
TTAGACATTGCAAAGTCATGTCCAGAAAATGAAGAAAGAATCTTATTGGCCATAGTAGAA
AAGTTATGCTACCTAGATGTTGACCTGAAAAGTAAAATTAGGAAGTTTTAGTTCTCATAA
ATAAGCAAGATTCAACCTATGAACTATTATATAAAAGAACTCTAAATGAAATTACCAACT
GATAAGGAAACCAAAATGTCTATACTTTTTGAAATGCTTCTTTCATACATTTTTGACAGA
GTAAAGGGAATCAATGAATAAAATAATTAATCAAACAATTTTGACGAATTCATTGAGAGT
ATGATGAAAATTTTTGAATCTAAAATCTTCCCGATACACAAATTGAGCTACATGCAGTAC
TTGCCATTGTATGTTATTTCTCTATCCTCAATGAATGAGAAATTGACTGTCTTCACAGAG
AAATACCTAAGTTTCCTTATATTTAAATCATTTAACATGATAGACAAAGAGCATTTAAGC
ACAAGACAGCAAGCATGGAATTATTTAGCTAGTCTTTTAGCTAGACAAAACAACATTCTT
GGTGAAAAGACTCTAATGAAAAGTTTGTAATATGTAATCAAGTTCTTTGACAACAATAGC
AGTTAAAAGACTAAGGCTAGGCGAACTGCCAGCAATCACTCATCAACAGAAGCATCTGAC
AATTTAGATATTAAACCAAATTAATTAGCTAGTCAAGACAAAATTCTCATGCATTGCTTC
ATTCAAGGACTCACTTTGATTCTATGCTCAAAGATTGACTAAATCTCTCAATATGATCAT
GACTTGTTTACATAAATGTGCAAACACATTTTCAAGAAAAATTTCAGCTCACTTATCTAT
GCATCACCACTTATTTTATCAGACCTGGTAAAACTAACTGAAAGTAATAAGCTTGGTCTT
GGAGTTTTCAAGACTAAACTTAGAGAACTTTTCAAGTAATAGTCTGAAGAATTGAAGAGC
AGTAGACGTCAAGTTTATAACAAGGTATCAAAGTTTATGGCATATGAAGTGCCAATAACT
GCTTACCCTGTTAGCGAAAGATTCTAAAATCTTATGATTTATGAGGATCTTAGCACTCTT
CCATCCTATTCAACTAACAATACACCATCCAAGTCTACAACTAATTTGATTGAGGCTATG
ACTGAGAGCGCTATAATGACTGAAAATGAAAGCCACATTAAGATACAAAGAAAGCTAAGA
CAAAATAATGAAGAAATTGACATTCCAACATCCAGCTAAGAAGAAGACAAGAGAAACTCA
AGTTTGATAAATACTGGAAATTAGTCTGATACTTCAACTGCATAAGCAGTTTTATACGTT
CCTGATGCTTCTCTGTATCCAAAAAACACTCAGGAGCAAATGATTGTAGATTACTCAGCT
AAAGGCTATTCATTGGAAAGCGTGATTTCACAATCGAAAGGATCAGATACACTATTTAGA
TTAAGACCAAACATGACTGAAAAGTCAGCAGTGTACCAAAGATCATCTACTATTACAGAG
TAAATTTCTAAGCTAAATCATATTAGTCTTAGTGCGCTAAATGCAGGACTTGATTCAACC
ATCGCACACTCTGAAGACATGGAAGTTGCCTCTTCAGGAAGAGACACTGAGTACTCTATA
TCACCTTCAATCTTTTAGAAACAAGGAAAGAGTGTTACTATTGGAAATATGGACGCACTT
ACCGAAAAGAGCAAAAGGAACAGAAGTATCTAGAGAACCACAAGAAACATTATGATGAAT
CTCAAGGAAGAGAACGACAGGGCAGATGCTTAAGATAGAATTAAAAGCTAACAAAATCAA
GTTATTTGA


>Contig22798.0.g85(protein)
MDLNKNILNPTNYFQTPLPLNPNRHLPQRPLLIKHSEEEVLQSFKIKRNALMEALQSKKE
GKLKNYYQIINRQGFVNAKEDSQALRIWVKVFLETITNIIHDYQDSELLELIVFKLPWFT
PTTTHGQNFNSFMRLCLAIFPHDVSYIHKVIKHIFSPHGLFQCVMLGEHRPALADLLWER
AQLIIKSFEMADESTGSNSGMQAQLTPQTQDSVQIDTRTEMKNDKSEIATENEFQPRLNR
IVDQEQIAIFQRILKEQKSSEDILARAKSILRNLSDQNQNQLVQVTDLNDQLFLRVLFSF
HPNRELPSDYKYPIFVGKCQGYPTFFVNSNLTSETYIPEDDDAISVKKCLSKIVQAYSLS
LKIFAEKKFNTSTLKKLGIFFSKVMNLYPFAHQFILQNLLEKLPHKSMPIENQYLYYRMV
LDIAKSCPENEERILLAIVEKLCYLDVDLKSKIRKFQFSQISKIQPMNYYIKELQMKLPT
DKETKMSILFEMLLSYIFDRVKGINEQNNQSNNFDEFIESMMKIFESKIFPIHKLSYMQY
LPLYVISLSSMNEKLTVFTEKYLSFLIFKSFNMIDKEHLSTRQQAWNYLASLLARQNNIL
GEKTLMKSLQYVIKFFDNNSSQKTKARRTASNHSSTEASDNLDIKPNQLASQDKILMHCF
IQGLTLILCSKIDQISQYDHDLFTQMCKHIFKKNFSSLIYASPLILSDLVKLTESNKLGL
GVFKTKLRELFKQQSEELKSSRRQVYNKVSKFMAYEVPITAYPVSERFQNLMIYEDLSTL
PSYSTNNTPSKSTTNLIEAMTESAIMTENESHIKIQRKLRQNNEEIDIPTSSQEEDKRNS
SLINTGNQSDTSTAQAVLYVPDASLYPKNTQEQMIVDYSAKGYSLESVISQSKGSDTLFR
LRPNMTEKSAVYQRSSTITEQISKLNHISLSALNAGLDSTIAHSEDMEVASSGRDTEYSI
SPSIFQKQGKSVTIGNMDALTEKSKRNRSIQRTTRNIMMNLKEENDRADAQDRIKSQQNQ
VI