Identifiers and Description

Gene Model Identifier

Contig22693.0.g40

Standard Name

None

Aliases

Contig22693_0_g40

Description

Kinesin motor domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002195859.997093137033517e-262kinesin heavy chain
SGDYGL216W2.0005330067840427e-93KIP3 SGDID:S000003184, Chr VII
from 84885-87302, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22693.0.g40(coding)
ATGTTAGTCGCAATTAGAATCAGGCCTTTGAATCAGAGAGAAATCGGCTTAAATGATAAA
GATATCATAAGATCAGAAGATAAACTTTTGATTGTACTTGATAAGGTCGAATTAGAATGT
AATGAAGAAGGAAAGAAACCTGAGATGCTGCATAGATCAAGAGAATAAAGATATTACTTC
GATAGAATATTTCCATAAGGATCAGACACTGAAACCGTCTATAAGAACACTTGTGAGCCA
CTTATTGACTCAATTATCTAAGGATATAATGGATGTGTATTTGCATATGGTACTACTGGT
AGTGGTAAAACTCATACAATGACTGGAAACACTGAAAATCCAGGAATAATGTACTTGATA
ATTAGAGGTATGTTTGATAGGATTCAAAATGAAAATGAAAAGAAGTTCGAAATCAAGGTG
TCATATGTTGAGATTTATAATGAAATCATCAGAGATTTATTAGTAGCAAACTCAAAAGAG
ACCTACTTAGACCTTCGTGATGACTCAGAAAAAGGAGTTTAACTAGCTGGAGTTACTGAA
TTCCAAGTATAAGAACCTCATTAAGTAATGAGTTTGTTGTAAATTGGTAATAAGAGGAGA
TCAACAGAGTCCACAAATGCCAATTAAACATCCTCAAGATCACACGCTATTTGCTAAATT
TAGTTAAGTGTAAAAGACAAACTATCCAACACTGAAAATGAAATACTTTGTGGTAAACTT
TCTTTGATAGATTTAGCGGGTTCTGAAAGAGGTACAGTTACTGAAAATAGAGGCATTAGA
TTGAGAGAGGGTGCTAAAATTAATACATCTCTTTTGGCTTTAGCAAATTGTATTAATGCA
TTAGGTGACAAAACCAAAAAAGGGTTCTTCGTACCTTTTAGAGATAGTAAGTTAACTAGA
ATGTTAAAGGACTCACTGGGTGGAAACTGTAAAACAGTCATGATAGCAACCATTTCGCCA
TCAAGTAGCCAGAATGAAGAAACAATAAACACATTGAAATATGCAAACAGAGCTAAGAAC
ATCAAAATGAGAGTAGAGCCAAATAAGAAAATGGTTTATCAACATATTAGTGCTTACAAG
AGCATTATTGCAGATTTAAGAGATGAGATTGATAGACTCAAAGCTTAACTACATAATGAA
TTAGGCTAGAGAAATAATCCACTAACCATCACCAAAACCTCAAAAGATATTGAACAGATG
AACCTGGAGGAGTAAAGATAAAAAACCTAACCTTTACAATAAGTATCATCCTTAATTCCT
AAAAGCTCTGATTGCAAGTGTGATTCAAGATTAAGAGATTAGATTGTGAAATTAGAAGTT
TAGTAAGAAATTGCTTAAGCTTATGAAGAAATAATTTAACTTGAACAAGCCTTAATTGAA
CTTGACGAATAGAACACTTTAAATGCCTTAGAAATCAGAAAAAGAGAAGCAAAAATGTTT
ATCTTATCTAGGCAAATTGAAGACATTGAGGAGGATAGTAAGAATGGCAAAGAAAATACA
GGTCCACTCAATGATCCCAATGCTGATTCAATTCCTAATGAAATTCAATAAATGCAAAGA
CAGATTGATCAGCACCATCATCAAATAGAGATTTTGAGTGAAAGTACTAAACAAAATTTA
CTAAAAAGACAATCAATGAAATAAGAGCTTTATGAGAATTACCAATAAATCAAACAGATA
AGACTTTCTATTGATTCAAGAATTGAAAACACAGAGGTATAGGATTATCTTGAACTCGTA
ATCAAGAATAATTTCTTAGAGAGTCAAAATGTGTAACTTTTGCTTAATTTGCAATTGCAA
GCAAGAACTATTATGGATTTAAAAAATATGATAGCAAAGTAGCAAAAATATATAGAGGAA
AATGATGTAGCTAATCAATCAGTCAACGGTGATAAAAATATCGACATATTTTTGGATGGA
GGTGATTTAGACTTTGAAGAATAAGATGTCTTAGATGATTAGTACATTTCAGATTTCCCT
GAAGAGAAATAGACACCAGCAGTATAATAGAGTAATATTGATACCTAGCCTCAACAGAGA
TAAGGTAATGGATCTATTGCTCCAAAGAAACAAAACTTAATGAGTGCAGCTGCTCACAAG
AAACCAGCAAAGTAGGATTCAGCCAAAATCTACTCTGCAAACCCTTCCACTAAAAATAAG
GATTAAAGCAAAGTAGCTCCTAAAAAGAAATTGTGA


>Contig22693.0.g40(protein)
MLVAIRIRPLNQREIGLNDKDIIRSEDKLLIVLDKVELECNEEGKKPEMLHRSREQRYYF
DRIFPQGSDTETVYKNTCEPLIDSIIQGYNGCVFAYGTTGSGKTHTMTGNTENPGIMYLI
IRGMFDRIQNENEKKFEIKVSYVEIYNEIIRDLLVANSKETYLDLRDDSEKGVQLAGVTE
FQVQEPHQVMSLLQIGNKRRSTESTNANQTSSRSHAICQIQLSVKDKLSNTENEILCGKL
SLIDLAGSERGTVTENRGIRLREGAKINTSLLALANCINALGDKTKKGFFVPFRDSKLTR
MLKDSLGGNCKTVMIATISPSSSQNEETINTLKYANRAKNIKMRVEPNKKMVYQHISAYK
SIIADLRDEIDRLKAQLHNELGQRNNPLTITKTSKDIEQMNLEEQRQKTQPLQQVSSLIP
KSSDCKCDSRLRDQIVKLEVQQEIAQAYEEIIQLEQALIELDEQNTLNALEIRKREAKMF
ILSRQIEDIEEDSKNGKENTGPLNDPNADSIPNEIQQMQRQIDQHHHQIEILSESTKQNL
LKRQSMKQELYENYQQIKQIRLSIDSRIENTEVQDYLELVIKNNFLESQNVQLLLNLQLQ
ARTIMDLKNMIAKQQKYIEENDVANQSVNGDKNIDIFLDGGDLDFEEQDVLDDQYISDFP
EEKQTPAVQQSNIDTQPQQRQGNGSIAPKKQNLMSAAAHKKPAKQDSAKIYSANPSTKNK
DQSKVAPKKKL