Identifiers and Description

Gene Model Identifier

Contig22636.0.g49

Standard Name

None

Aliases

Contig22636_0_g49

Description

Mitochondrial carrier protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005357302.000277046697593e-115Mitochondrial carrier protein
SGDYER053C1.0003180480544985e-86PIC2 SGDID:S000000855, Chr V f
rom 259639-258737, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22636.0.g49(coding)
ATGCCCGGAAGCGACGTTCACGACATGTCATATTATGCCAAATGCATGGTTGGAGGTATC
CTCTCATGCGGTATTACCCACACCCTTGTGTGCCCACTCGATATTATCAAGTGCAGAAAG
CAGGTCAACCCTACTCTCTACAAGAGCGTTGGTGATGGTTTCAGCACTATCTACAGAACA
GAAGGTTTCAGAGGTTTGACAGTCGGATGGGCTCCAACTTTCATTGGTTACTCCATGCAA
GGATTCGGAAAGTTCGGTTTCTATGAAATGTTCAAGGATGTCTACAAGACCGCATTCGGT
GTCAACGCTGCCAAGTATCAAACCTTCGGTTTCCTCCTCTCATCAGCCTGCGCTGAGGTC
ATTGCTGATTGTTTCCTCGCACCCATGGAAGCACTCAAAGTTAGAATGCAAACTGCTGAT
AAAGGTACCTTCACCACCAGCTTCACCAAGGGATTCAGCCAAATCAAGGCTAACGAGGGA
ATGAACGGCTTCTACAAGGGTCTCTCCCCACTCTGGATGAGACAAGTCCCATACACCATG
GTCAAGTTCGCCGCTTTCGAAAACACCGTCAAGGCTTTCTACTAGTATATCTTCACAAAC
CCAAGAGACACCTACTCAAAGAACTTCCAATTGATGATCACCTTCCTCTCAGGTTACTGG
GCCGGTATCTTCTGCGCTGTCGTTTCTCACCCAGCTGACGTTATGGTCTCAATCCTCAAC
AAAAAATCCTCAGATGCTCCAGTTCTTCAACAAGTTAAGGGTATCTACGGAGAAATCGGA
TTCAAGGGTCTATGGAACGGTCTTGGAGCAAGAATCGTCATGGTCGGAACCCTCACTGGT
CTCCAATGGTGGATCTATGATTCATTCAAGGTAGCCTGCGGTCTCCAAACCACTGGTGGA
AAGTGA


>Contig22636.0.g49(protein)
MPGSDVHDMSYYAKCMVGGILSCGITHTLVCPLDIIKCRKQVNPTLYKSVGDGFSTIYRT
EGFRGLTVGWAPTFIGYSMQGFGKFGFYEMFKDVYKTAFGVNAAKYQTFGFLLSSACAEV
IADCFLAPMEALKVRMQTADKGTFTTSFTKGFSQIKANEGMNGFYKGLSPLWMRQVPYTM
VKFAAFENTVKAFYQYIFTNPRDTYSKNFQLMITFLSGYWAGIFCAVVSHPADVMVSILN
KKSSDAPVLQQVKGIYGEIGFKGLWNGLGARIVMVGTLTGLQWWIYDSFKVACGLQTTGG
K