Identifiers and Description

Gene Model Identifier

Contig22569.0.g63

Standard Name

None

Aliases

Contig22569_0_g63

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000707709.997093137033517e-262DEAD/DEAH box helicase family
protein
SGDYHR065C6.997785648757479e-148RRP3 SGDID:S000001107, Chr VII
I from 229037-227532, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22569.0.g63(coding)
ATGGAAAATTCGACAAAGGGTGATTCTATCAAAGATCTAGTAGCAAAGCACAAAGCCAAG
GCTTTAGAAAAGGATTTATTTTGTTAATTAAAAACCTCCAAAGATCTAGAAAATGATTAA
GATGAAATTAAAGAAGAAGATATTGTAGAGGAAGAAAAGACCATTATGAGTAGCACTACT
TTTGAGAAATTGGGTGTTTGCTCAGAATTGTAGGAAGCCCTAAAAAACATGGGTTACAAG
TGCCCTACTAAGATTTAAGCAGAATCCTTGCAATATACTCTAAAAGGAAAAGACATTATT
GGTTTAGCTGAAACAGGTTCAGGAAAAACAGCTGCATTTGCCATTCCTGTCATCCAATAA
CTTCTTGATAACCCTCAACCATTCTTTGCCTGCGTTATGTCCCCAACAAGAGAACTATGT
GTATAGATTGCTGAATAGTTTGAAGCAATCGGAGCTGGTATTGGTTTAAGAACTGCAGTT
TTAGTTGGTGGTTTAGATATGGTTTCTCAAGCTATAGCACTCAGTAAAAATCCACATGTA
GTTATTGGAACCCCAGGTAGAATGGCAGACCATTTGGCAAACACTAAGGGATTCCATTTA
AAGAAACTTAAGTTCTTAATTTTTGATGAGGCTGACAGACTATTGAGCATGGATTTTGAG
AAATAAATCAACTTGATTTTGACTCAAATCCCTAAGAGCAGAAACACCTATCTTTTCTCT
GCTACGATGACATCAAAAGTATAAAAGTTACAAAGAGCTTCTTTGAACGATCCAGTCAAG
ATTGAAGTAAGCAGTAAATACAAAACCGTAGACACTCTCGTTCAAAATTATATTTTTATA
CCAGAAAAACACAAGGAAACCTATCTTGTTTACTTATTGACTTAATTTGCTGGCTAAAAA
ATGATAATCTTCACTACCACTTGCAATTAATCAATGAAGCTTGCTCTTATCCTTAGAAAT
CTCAACTTTAAGGCTGTAAACATCAATGGTCAGTTGACTTAAACTTAGAGATTAAGTGCT
TTGAACAAATTCAAGGCTAATGAGCGCAATATTTTGATAGCTACAGATGTGGCGAGCAGA
GGGCTTGATATTCCTGAAGTCGATTTTGTTATAAACTTTGATATTCCATAACACTCAAAA
GATTACGTGCATCGTGTAGGCAGAACAGCTCGTGCAGGTAAGACAGGTAAAGCTATAACA
TTTGTAACACAGTATGACGTGGAAACATTCTAAAAAATTGAGCAACTTATCGACAAGAAA
CTTGACGAATATCCAGGGTTAGATAGTAAGGCAGCTTTGATCTTAACTGATTCAGTAGTC
GAAGCAACTCGATTAGCTGTATTTGAGATGAAAAACAGAGAAGGCAAACATGGGAAATCA
GTCGATGGTCCTGACGGAGATGACGATGAAGAAACAAATAAAGACATGAAACTTTTTGGC
AAGAAAAAATAGAGCAATAACTTTGCTCACAAAAAGGGATTTAATGGTACTAAAAGTTTT
GCCAGAAAGAGACCTAGAAATAACTGA


>Contig22569.0.g63(protein)
MENSTKGDSIKDLVAKHKAKALEKDLFCQLKTSKDLENDQDEIKEEDIVEEEKTIMSSTT
FEKLGVCSELQEALKNMGYKCPTKIQAESLQYTLKGKDIIGLAETGSGKTAAFAIPVIQQ
LLDNPQPFFACVMSPTRELCVQIAEQFEAIGAGIGLRTAVLVGGLDMVSQAIALSKNPHV
VIGTPGRMADHLANTKGFHLKKLKFLIFDEADRLLSMDFEKQINLILTQIPKSRNTYLFS
ATMTSKVQKLQRASLNDPVKIEVSSKYKTVDTLVQNYIFIPEKHKETYLVYLLTQFAGQK
MIIFTTTCNQSMKLALILRNLNFKAVNINGQLTQTQRLSALNKFKANERNILIATDVASR
GLDIPEVDFVINFDIPQHSKDYVHRVGRTARAGKTGKAITFVTQYDVETFQKIEQLIDKK
LDEYPGLDSKAALILTDSVVEATRLAVFEMKNREGKHGKSVDGPDGDDDEETNKDMKLFG
KKKQSNNFAHKKGFNGTKSFARKRPRNN