Identifiers and Description

Gene Model Identifier

Contig22561.0.g33

Standard Name

None

Aliases

Contig22561_0_g33

Description

tRNA synthetase class II core domain (G, H, P, S and T)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam03129 ) Anticodon binding domain
  • ( pfam01145 ) SPFH domain / Band 7 family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001069409.997093137033517e-262glycyl-tRNA synthetase family
protein
SGDYPR081C9.997093137033517e-262GRS2 SGDID:S000006285, Chr XVI
from 703970-702114, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22561.0.g33(coding)
ATGGTCGAAAAGGCTGCAGGTCCAACTGATTACATAAAGAAGTATCAAAGAGTAAAGTGC
GAAGATTTGTTGAAGAGAAAGTTCTTCTACGTGCCCAGCTTCGAAATCTACGGTGGAGTA
GCTGGTCTCTATGATTATGGTCCACTTGGTTCTCAACTCAAGAGCAACGTTGAGACACAA
TGGAGACAACATTTCGTATTAGAAGATGACATGTTGGAAGTCACTTGCTCAAATCTCACT
TTAGATGAGGTTCTTAAAACATCTGGTCACGTCGACAAATTCGCAGACTTTATGGTTAAA
GACGTAAAGAATGGCATTTGCCACAGAGCTGATAAGTTGATTGAAGACTTCGTTGAGAGA
GCTATCTAAAAAAAGAAGGATATGAAATAAGAAGATAGGGACAGATTGAATAGAATTGCC
GCTGATGCTGGTTCCATGAAGGCTGAATAATTGAACATTACTATTAAGGAGCTTAACATT
AAGTCTCCAGACACTGGTAACGATCTTTCCGAGGCTATGCCATTCAACTTAATGTTCGAA
ACTTTGATTGGTCCCACTGGCCAACTCAAGGGTTATTTGAGACCAGAGACTGCTCAGGGT
ATCTTCATTAACTTCAGAAGACTACTTGAGTTCAACAATGGTAGAATGCCATTTGCTGCT
GCTTAAATTGGTCTTGGTTACAGAAATGAAATCCATCCCAAGCAGGGTCTCTTAAGAGTG
AGAGAGTTCACCATGGCTGAAATTGAACACTTCGTTGACCCAACCAACAAGAAGCATCAC
AAATTCTACAAGGTTAAGGACATCCAACTCCCCCTCTTCTCCGCTGAGAACCAAATGACC
AACGAGAGAGCTATGATTAGAGATTTGCCCCTAGATTCCGCTGTTGAAAAAGGTGTGATC
AACAACGAGACTCTTGCATACTTTATGGCTAGAACTTTCCAATTCCTTGTGAATGTTGGT
ATCAGCCCAGAGGCCATTAGATTCAGACAGCACAGAGACGACGAAATGGCTCATTACGCC
TAAGACTGCTGGGATGCTGAGGTTGAGACTTCTTATGGGTGGATTGAAGTAGCTGGTCAT
GCTGATAGATCTTGCTATGATCTCTCCAGACACTCAGCCAGAACAAAGGTTGAACTTCTC
GCTGCTAGACAATTGAAAGAACCAAGACATGTTAAGCTTGTTAAGATTATCGTCAATAGC
AAAGAAGTTGGTAAAGTTTTCAAGCAAGACGCAAAGGCAATCAAGGAATTCCTTGAGGAG
GCTGAAGAAGAAGTTAAACAACAATTACACAAACAATTAGTTGAGAATGAGAAAGTTACT
ATAACTATTGGTGAAAAGAGCTTTGAGCTCACCAAGGAACATGTCACCATGGACGTTGTA
GATAAGATTGTTCAAGAAGAGAAATACACTCCATCTGTAATTGAGCCATCATTTGGTATC
GGTAGAATCGTGTACTGTGTGTTCGAGCACTGCTTCAAGCAAAGAGAAGAAGATGCTCAG
AGAACCTATTTCACCTTCCCACCACTCATTGCCCCAGTCAAGTGCTCCATTTTGCCACTC
ATGGACAAGCCAGACCTCAATAAATTCGTTCAAGATATCAAGTCATACTTGACCAAGGCT
GGTATCTCCTCCAAGATTGACGATTCAGGACAGACCATCGGTAAGCGTTACGCCCGTACT
GACGAATGCGGTATCCCCTTCGCCATCACCGTGGACTTCGACACCCTCACTCAGGAGTCA
GTCACTCTCAGAGACTTGCACACCATGAAGCAAGTCCGTATGCCCATCGCTGACTTGGCC
ACCAACATTTCTCAGTTGTCCAATGGCTTGAAGACTTGGGATGAAGTCATCACTCAGTAC
CCTCTCTTCCAATCAGGCGCTGCTGCTTCAGAATGA


>Contig22561.0.g33(protein)
MVEKAAGPTDYIKKYQRVKCEDLLKRKFFYVPSFEIYGGVAGLYDYGPLGSQLKSNVETQ
WRQHFVLEDDMLEVTCSNLTLDEVLKTSGHVDKFADFMVKDVKNGICHRADKLIEDFVER
AIQKKKDMKQEDRDRLNRIAADAGSMKAEQLNITIKELNIKSPDTGNDLSEAMPFNLMFE
TLIGPTGQLKGYLRPETAQGIFINFRRLLEFNNGRMPFAAAQIGLGYRNEIHPKQGLLRV
REFTMAEIEHFVDPTNKKHHKFYKVKDIQLPLFSAENQMTNERAMIRDLPLDSAVEKGVI
NNETLAYFMARTFQFLVNVGISPEAIRFRQHRDDEMAHYAQDCWDAEVETSYGWIEVAGH
ADRSCYDLSRHSARTKVELLAARQLKEPRHVKLVKIIVNSKEVGKVFKQDAKAIKEFLEE
AEEEVKQQLHKQLVENEKVTITIGEKSFELTKEHVTMDVVDKIVQEEKYTPSVIEPSFGI
GRIVYCVFEHCFKQREEDAQRTYFTFPPLIAPVKCSILPLMDKPDLNKFVQDIKSYLTKA
GISSKIDDSGQTIGKRYARTDECGIPFAITVDFDTLTQESVTLRDLHTMKQVRMPIADLA
TNISQLSNGLKTWDEVITQYPLFQSGAAASE