Identifiers and Description

Gene Model Identifier

Contig22552.0.g51

Standard Name

None

Aliases

Contig22552_0_g51

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009388209.997093137033517e-262Elongation factor G, domain IV
family protein
SGDYOR133W9.997093137033517e-262EFT1 SGDID:S000005659, Chr XV
from 575098-577626, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22552.0.g51(coding)
ATGCCCAACTTCACTGTTGATTAAATCAGGGAGATTATGTATATCCCCAACCAAATTAGA
AACATGTCAGTTATTGCCCACGTCGACCATGGAAAGTCTACTCTTACTGACTCTTTGATT
GCAAAGGCCGGTATTATTTCCGAGGCCAACGCTGGAAACGCCAGATTCACTGATACCAGA
GCTGATGAGCAAGAGAGAGGTATCACCATTAAGTCAACTGGTGTCTCCCTTTACTACGAA
TCCGACATCGAAGGAGACAAGAGACCATACTTGATCAACTTGATCGATTCCCCAGGTCAC
GTCGACTTCTCATCTGAAGTTACTGCTGCCTTGAGAGTCACAGACGGTGCTCTCGTCGTC
GTCGATTACGTCGAAGGAGTCTGTGTCCAAACTGAAACTGTGCTCAGACAAGCCCTCGGT
GAGAAGATCAAGCCAGTTCTTTTCGTTAACAAGATTGACAGAGGTATTCTCGAACTCCAA
GTCGAAGGTGAACACATGTATCAAAACTTCCAAAGAGTTATTGAAAACGCCAACGTTATC
ATCTCTACCTACGAAGCTGATGATATGGGAGAAGGTCAACAAGTTGACCCATGCAAGGGT
ACCGTTGCCTTCGGTTCAGCCCTCTTCGGTTGGGCCTTCACCCTTACCAGATTCGCCAGA
ATCTACGCCAACAAGTTCAACGTTGACTTCGACAAGATGATGTAAAAGCTTTGGGGTGAT
AACTTCTATGATGCCAAGGGAAAGAAATGGAAGATTGACCAAGATGCCGATGATGGATCC
GTCCTCAAGAGATGCTTCGTCCAATTCATCATGGAGCCAATTGTCAGACTCTGCAGAAAC
ATCATGGATAACAACAAGGATGCCGTCTGGAAAATGCTCACCACTCTTGACGTTTAACTC
AAGAACGAAGATAAAGAAAAGCAAGGAAAGGATCTCCTCAAGGCTGTCTTCCAAAAGTGG
ATCAACGCTGCTGATGCTCTTTTAGAGATGATCGTCATGAAACTCCCATCCCCAGCTACC
GCTCAAAAATACAGAGCTGCCTATCTCTATGAGGGTCCAATTGATGATCCATGCGGACAA
GCCATCAAGAACTGCGATCAAAAGGGTCCACTCATGGTCTTCATCTCAAAGATGGTGCCC
ACTAACGATAAGGGTAGATTCTACGCTTTCGGAAGAGTCTTCTCAGGAGTCGTCCAAACT
GGTCAAAAGGTCAGAATCATGGGACCAAACTATACCCCAGGTTCCAAGAACGATCTCAAC
GTTAAGAACATCCAAAGAACCGTTCTCATGATGGGAGGTAAAGTCGAAGCCGTTCCAGAT
GTACCATGCGGAAACACTGTTGGTCTCGTCGGAGTTGATCAATATCTTCTTAAGCAAGGT
ACCATCTCAGATCACGAAGATGCCCACAACATCAGAGTCATGAAGTACTCAGTCTCCCCA
GTCGTCAGAGTCGCTGTTGAGCCAAAGCACGCCTCAGATCTTCCAAAGCTCGTCGAAGGA
CTTAAGAAGCTCTCAAAGTCAGATCCATTAGTTCTCTGCTACACTGAAGAATCAGGTGAG
CACATTATTGCTGGCTGCGGTGAGCTCCACGTCGAAATCTGCCTCAAGGATTTGGTTGAA
GAGTACGCTAAGTGCGAAATCAAGAAATCCGACCCAGTCGTCACATACAAGGAAACCGTC
ACTGAAACCTCATCTCAAATGTGCCTCTCCAAGTCACCAAACAAGCATAACAGACTCTAC
GTCCTCGCCGCCCCACTTGGTGATGATGTTACCAATGCCATCGAAGCTGATGATATCTCA
TCCAAGCAAGATCAAAAGGAGAGAAACAGAATCCTCGCCGACAAGCACGGTTGGGATATC
AATGACGCCAAGAAGATCTGGTGCTTCGGTCCAGAGACCTCAGGCCCTAACCTTCTCGTT
GATCAAACCAAGGCTGTCCAATATCTTAACGAAATCAAGGACTCTTGCGAAGCTGCCTTC
CAATGGGCCACCAAAGAAGCCGTTATGACTGAGGAAAACATGAGAGGTATCAGATTCAAC
ATTATGGACGTTGCCCTCCACGCCGACGCTATCCACAGAGGTGGTGGACAAATCATCCCA
ACTGCCAGAAGAGTCTTCTACGCTGCTCAACTCACTGCTTCCCCAAGATTCGTTGAACCA
ATCTTCTTGTGCGAGATCCAAGCCCCAGATGATGCTATGGGAGGTATCTATCAAACTCTT
ACCCAAAGAAGAGGTATCGTTATCGGTGAAGAGCCAATTAACGGAACCCCACTCATCATC
GTCAAGGCCTACTTGCCAGTCGCTGAGTCATTCGGTTTCACTCAACACTTGAGAGCCATG
ACTTCAGGAAGAGCTTTCCCACAATGCGTGTTCGACCATTGGGAAAATATTGCCACCGAC
CCAACTGAACCAACTTCAAAGTCAGGTGTCTTGGTTGAAACCATCAGAAAGAGGAAGGGA
CTTAAACCAGGTATTCCACTTCTCGAAAACTTCCTCGACAAGCTATGA


>Contig22552.0.g51(protein)
MPNFTVDQIREIMYIPNQIRNMSVIAHVDHGKSTLTDSLIAKAGIISEANAGNARFTDTR
ADEQERGITIKSTGVSLYYESDIEGDKRPYLINLIDSPGHVDFSSEVTAALRVTDGALVV
VDYVEGVCVQTETVLRQALGEKIKPVLFVNKIDRGILELQVEGEHMYQNFQRVIENANVI
ISTYEADDMGEGQQVDPCKGTVAFGSALFGWAFTLTRFARIYANKFNVDFDKMMQKLWGD
NFYDAKGKKWKIDQDADDGSVLKRCFVQFIMEPIVRLCRNIMDNNKDAVWKMLTTLDVQL
KNEDKEKQGKDLLKAVFQKWINAADALLEMIVMKLPSPATAQKYRAAYLYEGPIDDPCGQ
AIKNCDQKGPLMVFISKMVPTNDKGRFYAFGRVFSGVVQTGQKVRIMGPNYTPGSKNDLN
VKNIQRTVLMMGGKVEAVPDVPCGNTVGLVGVDQYLLKQGTISDHEDAHNIRVMKYSVSP
VVRVAVEPKHASDLPKLVEGLKKLSKSDPLVLCYTEESGEHIIAGCGELHVEICLKDLVE
EYAKCEIKKSDPVVTYKETVTETSSQMCLSKSPNKHNRLYVLAAPLGDDVTNAIEADDIS
SKQDQKERNRILADKHGWDINDAKKIWCFGPETSGPNLLVDQTKAVQYLNEIKDSCEAAF
QWATKEAVMTEENMRGIRFNIMDVALHADAIHRGGGQIIPTARRVFYAAQLTASPRFVEP
IFLCEIQAPDDAMGGIYQTLTQRRGIVIGEEPINGTPLIIVKAYLPVAESFGFTQHLRAM
TSGRAFPQCVFDHWENIATDPTEPTSKSGVLVETIRKRKGLKPGIPLLENFLDKL