Identifiers and Description

Gene Model Identifier

Contig22487.0.g85

Standard Name

None

Aliases

Contig22487_0_g85

Description

Proteasome subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005481605.002115178225629e-63Proteasome A-type and B-type f
amily protein
SGDYFR050C8.99567666834855e-44PRE4 SGDID:S000001946, Chr VI
from 249866-249066, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22487.0.g85(coding)
ATGGATCTAATCTCAGGCTCATAACCAAGAACTCACACTCAAGTGCCAGTCAATATTGGT
ACCTCTGTCATGGGACTCAGATACAAAGATGGAGTCATGTTGGCTGCAGATACCGCTGTA
GCCTATGGTTCAATGAAAAAGACCAAGCATGCTAAGAGAATGGCTCCCTTGTCAGTAGAC
ACTGCCATTGCCTGCTCAGGAGAAATGAGTGACTTCCAAGAGTTGCTTAAGATCTTCAAG
GACAAGCACGAAAGTGACGTTATTGAGAATGACGGTGCTCTTTTCTTGAAGCCAAGAGAC
TACTTCAACTATCTGTCTAGAGTCTAGTACTAGAGAAGAATGAAGATGGACCCATTGTGG
AACGGTACTATTGTTGGAGGTGTCAGCCAAACCAATGGTGAAGTCTTCCTTGGAATGGTT
GACTTGTACGGAACCAAAGTTGAAGGTAACTTCCTTTTGACTGGATTAGCCGCACATTAC
TGCCAAGTTTTAATGCAAAACGCTTGGAGACCAGACTTGTCTGAGGAAGAAGCAAGAAAA
GTTATCGAAGACTGCATGAAAGTCATGTTCTACAGAGACAAGAAAGCAAGTGACGAGATT
CAGATCACTACTATCACTAAGGATGCTGGTGTCCAGATACACGAACCATACAAGATTGAG
GGTGAGTGGAACTTCAACTTCTTCCGTGAGAAGACCAACGAGTTCTGGAGACCAATCAGA
ATCTACAACAATTGA


>Contig22487.0.g85(protein)
MDLISGSQPRTHTQVPVNIGTSVMGLRYKDGVMLAADTAVAYGSMKKTKHAKRMAPLSVD
TAIACSGEMSDFQELLKIFKDKHESDVIENDGALFLKPRDYFNYLSRVQYQRRMKMDPLW
NGTIVGGVSQTNGEVFLGMVDLYGTKVEGNFLLTGLAAHYCQVLMQNAWRPDLSEEEARK
VIEDCMKVMFYRDKKASDEIQITTITKDAGVQIHEPYKIEGEWNFNFFREKTNEFWRPIR
IYNN