Identifiers and Description

Gene Model Identifier

Contig22482.0.g88

Standard Name

None

Aliases

Contig22482_0_g88

Description

Dynamin central region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004867909.997093137033517e-262Dynamin central region family
protein
SGDYKR001C6.999576669079256e-104VPS1 SGDID:S000001709, Chr XI
from 442722-440608, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22482.0.g88(coding)
ATGGATAAAGCAGGCAAGCTAGAGAAAAAGGATGATGGAGGTCTACTCTACAACAACTTG
AGAAAACTTATTAGTATAGTCGATGAACTTAGAGATGTCGGTCTTTAACAATACATTAAC
TTACCAAGAATTGCAGTACTCGGTACACAATCATCAGGTAAATCTTCGGTCTTGGAATCT
ATTGTTGGTCTGGACTTTCTTCCCAGAGGAGATGGTGTCGTCACAAGAAGACCACTTGAA
TTGAGACTGAATCATCAACCAGAAGATGTGAAACCATGGGCAGTTTTCGAAGAGATCCCA
GGCAAAAGAATTTATGATTTCTAGGAAGTGAGAAAGAATATTGATATATTGACAGATAAG
GTAGCTGGTGCTAAGAAGGGTATTGTTGATAAGCCAATCGTCCTCAACATTTACTCACAC
ACCTGCCCAGATTTGACGCTTATTGATTTGCCAGGTATCACTAGAATTCCTCTTGCTGGT
TCTGATCAACCAAATAACATCGAATAAATTACCAGAGCTATGGCCAATAGATACGTCTCC
GATCCCAGAACCATTATTCTTTGCGTTATCTCAGCTAATGCTGATATGACTACCTCAGAT
GGTCTCCAAATGGCTAGAGAGCTCGATCCTAAGGGTTTAAGAACATTGGGTGTACTCACC
AAGATTGATATCATGGATAAAGGTACAAATGCCAAGAGAATGTTGACTGGTCAAGATGTA
CCCTTAAGATTAGGTTACGTTGGTGTAAAGAATAGATCACAACAGGACATTATCGATAAC
ATGAGTGTTAAAGATGCTATTGAAAGAGAAAAGCTTTACTTCGCTACTCATCCAGTTTAT
TCAACTATGCCACCTGGCCTTCTTGGTACCGATCTATTGTCATAGAAATTGTCTAAGGTT
ATGTTTACTCACATTAAGCACAATCTTCCAGAAATTACGAAAGAAATTAGAGAGAAAGCT
AAGGAAATTGAAGAAAGATTGAGAGATCTTGGTCCACCTCTTCCATTCGACGGTACAGAA
AAGATGCACTTGCTCTGGAACATGATCACTGATTTTGTTACTATTTACAAAAATACCATT
ACTGGTAAATTTGATTCAAAGAGGTATGCCAATAGCAACCCATCTGGCAAGAAGGAACTT
TCTGGTGGAGCTAAAATTAAGTTACATTTCTATGGCTTATACAAGCAATTTGTGAACTTT
AATGCAACTAGCGAGTACACAGATATGGATATTGAAAAGGCTATCATGCTCCATGAAGGT
GATACCATTCCAGGTTTCCCTTCAGTTGATGTCTTCATCTATCTTATTCAACCATAATTA
GAGAAGCTCAGAGAGCCCGCTCAAGATTTACTTCAGGATGTCTACCATATGTTGGAATAA
ATGGCCTAGGGTATTGTTGAAAGAATTTTCTCAAGATTCCCATCTATGATTCCTGAGGTT
ATGGATATCATTACCACTGTGCTTCAAGACGAAAGAGAAAAGTGCAGAACTATTGCTGAA
TCTATCATTGATAGTGAGTAGAACTATCTTTTCACAAATGACTACGACTATCTATAAAAC
AGAACTGATATCGTTCCTCAGCAAGAACAAGCACCAGCTTAAAATAACCCATAAGGTTAA
AATGCTGCAGGTTAGAATCAACCAGTTGGTTCATAGATTTAAAATGCTTTCAAGAGTAAT
GCTAATCAAAGCAGTAAAGGCAGCAACTTATTCGTTAAAGAAATCAGAGCAAGAATCGAT
GCTTATTTCAAGCTTGTTGTTAGAAATGTCAGAGACTCTATTCCAAAAACTATTGGTTAT
TTCCTTGTCAAGTCATCTCAAGAAAGACTTCAATTCGAACTTTACGCTCAAATTAACAAA
AATGAATAATTGACTAAACAGCTTGGTGAGCCAGAGAGAGTAACTGAAGAGAGAAAATCA
TTGAATGGAACATTAGATACATTGAAAAAGGCTATCAAGGTTCTCTAAAGAGATCCAGAT
ATCACAAACACTGCATTCGGTGAAGATGAATTAGAAGAACAGCTACGTCTTGATTCCATG
AGTAAACGTAGAGAAGCAGAAGCACAAAGAAGACCAAACACATCTTAGTAATAGTAATAG
AATTAATAATATAACTCGTAACCACAACAAGATATGGATGGAAGAACTATGAGTATGCAA
TAAAATAGACCACCTCCTTAAAACATGGGTCCAGGTGGAAATATGCCACCAGGTATGCAA
TAACCACAAAACAGACCTCCTGGTTAAATGCCACCAGGTGGAATGGGAATGCCCCCTGGT
CAAAGACCCCCCGGTATGCCCCCTGGTGGACAAGGTGGCAATCTAGGTAATCTCTTCGGC
GAAGATCCTCTCAAGAACGGTCAAGGCCCTCCTAAGAGACAATGA


>Contig22482.0.g88(protein)
MDKAGKLEKKDDGGLLYNNLRKLISIVDELRDVGLQQYINLPRIAVLGTQSSGKSSVLES
IVGLDFLPRGDGVVTRRPLELRLNHQPEDVKPWAVFEEIPGKRIYDFQEVRKNIDILTDK
VAGAKKGIVDKPIVLNIYSHTCPDLTLIDLPGITRIPLAGSDQPNNIEQITRAMANRYVS
DPRTIILCVISANADMTTSDGLQMARELDPKGLRTLGVLTKIDIMDKGTNAKRMLTGQDV
PLRLGYVGVKNRSQQDIIDNMSVKDAIEREKLYFATHPVYSTMPPGLLGTDLLSQKLSKV
MFTHIKHNLPEITKEIREKAKEIEERLRDLGPPLPFDGTEKMHLLWNMITDFVTIYKNTI
TGKFDSKRYANSNPSGKKELSGGAKIKLHFYGLYKQFVNFNATSEYTDMDIEKAIMLHEG
DTIPGFPSVDVFIYLIQPQLEKLREPAQDLLQDVYHMLEQMAQGIVERIFSRFPSMIPEV
MDIITTVLQDEREKCRTIAESIIDSEQNYLFTNDYDYLQNRTDIVPQQEQAPAQNNPQGQ
NAAGQNQPVGSQIQNAFKSNANQSSKGSNLFVKEIRARIDAYFKLVVRNVRDSIPKTIGY
FLVKSSQERLQFELYAQINKNEQLTKQLGEPERVTEERKSLNGTLDTLKKAIKVLQRDPD
ITNTAFGEDELEEQLRLDSMSKRREAEAQRRPNTSQQQQQNQQYNSQPQQDMDGRTMSMQ
QNRPPPQNMGPGGNMPPGMQQPQNRPPGQMPPGGMGMPPGQRPPGMPPGGQGGNLGNLFG
EDPLKNGQGPPKRQ