Identifiers and Description

Gene Model Identifier

Contig22405.0.g93

Standard Name

None

Aliases

Contig22405_0_g93

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010792109.99648502569394e-38Ras family protein
SGDYLR262C4.001033848388204e-30YPT6 SGDID:S000004252, Chr XII
from 668891-668244, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22405.0.g93(coding)
ATGGCATCTAAAAACTAAGATTTAAAGAAAGGCATTGATTAATCTGACGATGACTCAGGG
GACGAGCCAGAAAACTATCAATATAAAATTGTGGTTTTGGGCAACGGAACCGTTGGAAAA
ACCTCAATTATCATGCGTTTTTGTGAGGATCATTTCGCTCGCTCATACAAGCAAACCATA
GGAGTGGATTTCTTTGTAAAGAGACTTGAAATGCCAGGTAACGTACACGTTGCTCTGCAA
GTGTGGGATATTGGAGGACAAAGTATATTTGGCAAAATGATCTAAACTTATATTTATGAA
GCCAACGCTGTAATCTTAGTATATGACATAACAAATCAACAATCATTCTAAGACCTAGAC
GACTGGCTGAATTTAGTGCGTTAGTCCTTCGTCGGCAAAGAAATGCCTCTACTTGTCTTA
ATGGGAAATAAAATTGATTTAAATCACATGCAAGCAGTGAAGAGCGATTAACATGATTAA
TTTGCGAAATAAAACGGACTTTATTCTTTCTACGTGTCTGCTAAATCAGGTGATTAGGTT
AGCTCATGTTTTTACAGATTAGCTGCTGACCTTGCAGGAATTGAAGTATCTAAGCCAATG
ATAGAAATAACTTAAAAATAAGTGAAGGCAGAGATAGTAGTTCAGCACACTTAAAACGAA
GATACTGAACCCAGAGCAGAAGAAAAACTTGAACAAGCAAAAAAGAAGGATTCTAAATGT
CTCATATTTTGA


>Contig22405.0.g93(protein)
MASKNQDLKKGIDQSDDDSGDEPENYQYKIVVLGNGTVGKTSIIMRFCEDHFARSYKQTI
GVDFFVKRLEMPGNVHVALQVWDIGGQSIFGKMIQTYIYEANAVILVYDITNQQSFQDLD
DWLNLVRQSFVGKEMPLLVLMGNKIDLNHMQAVKSDQHDQFAKQNGLYSFYVSAKSGDQV
SSCFYRLAADLAGIEVSKPMIEITQKQVKAEIVVQHTQNEDTEPRAEEKLEQAKKKDSKC
LIF