Identifiers and Description

Gene Model Identifier

Contig22392.0.g29

Standard Name

None

Aliases

Contig22392_0_g29

Description

Ras family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00071 ) Ras family
  • ( pfam00025 ) ADP-ribosylation factor family
  • ( pfam08477 ) Miro-like protein
  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam04670 ) Gtr1/RagA G protein conserved region
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam09439 ) Signal recognition particle receptor beta subunit
  • ( pfam02421 ) Ferrous iron transport protein B
  • ( pfam10662 ) Ethanolamine utilisation - propanediol utilisation
  • ( pfam03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFL005W6.997942222381785e-66SEC4 SGDID:S000001889, Chr VI
from 130334-130981, Genom...
T. thermophilaTTHERM_001269502.9995010303521745e-64Ras family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22392.0.g29(coding)
ATGTCATCCTTTAAGAAGCCAGGTTACGATCACTTACTCAAACTTATTATTATTGGCGAT
TCCTCAGTTGGAAAAACTTGCCTACTGCTCCGCTTCTCAGAGGACTCCTTCCCCGTGTCG
CATATGCCCACTATTGGAATTGACTTCAAAATTAAAAAGATAAACGTAGATGATAAAAGA
GTGAAGTTACAAGTGTGGGACACTGCAGGCCAGGAGAGATTCAGGACAATCACTCAAACT
TATTATAAGGGAGCTATGGGGATAATTTTAGTTTATGACTGTACCGACTAACAAACTTTC
AATAACATACAAAACTGGCTAAAATAAATTGATCAACATGCTAACTAAAATGTTGCAAAA
GTGCTTGTTGCTAACAAATGCGACAAGCCAGACAAAGTGATTGAGACAGAGAGAGGCAAG
CAGCTGGCAGCAGATCACGGTTTGTTGTTCTTTGAGACCTCAGCCAAAACTGGCCACAAT
GTGAATGAAGTCTTCCACCAAATTGCCAATGTGATTGTCAGAGAGAAACTGCCAGCAATC
CAAGGTAATGCAGGAGGAATGAACTAGGGTGGATTCGCTGGTTAAAACGCTGCCAGGTAA
CAACAAAAAAATAACTTCAAAATGGGGGATCGTGACAATGAACAGAAGAAGAAGGAGAGC
TCGTGCTGTTGA


>Contig22392.0.g29(protein)
MSSFKKPGYDHLLKLIIIGDSSVGKTCLLLRFSEDSFPVSHMPTIGIDFKIKKINVDDKR
VKLQVWDTAGQERFRTITQTYYKGAMGIILVYDCTDQQTFNNIQNWLKQIDQHANQNVAK
VLVANKCDKPDKVIETERGKQLAADHGLLFFETSAKTGHNVNEVFHQIANVIVREKLPAI
QGNAGGMNQGGFAGQNAARQQQKNNFKMGDRDNEQKKKESSCC