Identifiers and Description

Gene Model Identifier

Contig22315.0.g10

Standard Name

None

Aliases

Contig22315_0_g10

Description

Nucleosome assembly protein (NAP)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010481303.000555717977434e-27ankyrin repeat
SGDYKR048C2.000620012690291e-23NAP1 SGDID:S000001756, Chr XI
from 526640-525387, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22315.0.g10(coding)
ATGACAGATATCTAATTTGAAGATCCAGAGCAAAAGGAATTCGATCTTAAAATGTCAAAG
ACCATCGAAGCTATGCCAGCTGAGGTCAAGGACAGATTCAAGGCTCTCAAGGTTCTACAT
GATCAATAAACCGAGATTGATGAAGAAGAGCAGAAACTATATAGAGATCTTGAATTGAAA
TACGACAAGCTTTATCAAGAGATCTATGAGCAAAGAAAATCTTTGTTATCAGGAGCCGTG
CCACCCTCTGAAGCTCTCCTCGCTGAGTATGCTACCAGAGCAACCGAGCTAGATGATGAG
GATTACAAGAAGGTTGAAGCCACTCCAATCGACGTGAAAGATATTCAGAACACCCCACTC
GGAGTATATGGTTTCTGGTTTAAGGCCATGTTGAACCACGGTCTTATGAGCAGACTTATT
CAAGAGAAAGATAGACCAATCTTGATGCACTTGCAAGATGTCTAATGCAAACTTCACGAA
GCTGGTCATGGTTACGATTTAGTATTCACTTTTGAAAAGAACGACTACTTCTCTAACGAG
ACCTTGAAGAAGTCCTTTGTTATGACTAAATCAAATATCATTGAGAAGTGCGAGGGTACC
CCAATTTCATGGAAAGACGGCAAGGATGTTACTTAAAAGAAGGTAAAGAAGAAGAACAAG
AAGAAGGGCAAGACCACCACCGTCACCAAGACAGTTGATTGCGAGAGTTTCTTCAACTTC
TTCAAGACCATCGAAATGCCAGACGAAAAGGCACTTGAGGGAAAGAAAGACGATGACGAA
AAAGATCCAGAAGAAGAAGAGAAGGACGTTGGAGAATTAATGGACGCAGATTTCGATATT
GGTAATGAATTCAAGGACCAACTCATTCCCCTTGCCCTCGAATATTACATGGAAGTAATC
TAGGAAGAGGACGAAGAAGACCACGATTGCAGCGATGACGAGTGCGGAGGTGGACACGGC
CACGACCACTCAGATGAAGAAGACCAACCAAAGCCAAAGAAGAAGGCAGGCAAGAAGGGA
GCAGACGCCGCCGGAGCAGCTGCTGCAGGCCAACAAGAATGCAAATAACAGTGA


>Contig22315.0.g10(protein)
MTDIQFEDPEQKEFDLKMSKTIEAMPAEVKDRFKALKVLHDQQTEIDEEEQKLYRDLELK
YDKLYQEIYEQRKSLLSGAVPPSEALLAEYATRATELDDEDYKKVEATPIDVKDIQNTPL
GVYGFWFKAMLNHGLMSRLIQEKDRPILMHLQDVQCKLHEAGHGYDLVFTFEKNDYFSNE
TLKKSFVMTKSNIIEKCEGTPISWKDGKDVTQKKVKKKNKKKGKTTTVTKTVDCESFFNF
FKTIEMPDEKALEGKKDDDEKDPEEEEKDVGELMDADFDIGNEFKDQLIPLALEYYMEVI
QEEDEEDHDCSDDECGGGHGHDHSDEEDQPKPKKKAGKKGADAAGAAAAGQQECKQQ