Identifiers and Description

Gene Model Identifier

Contig22293.0.g19

Standard Name

None

Aliases

Contig22293_0_g19

Description

short chain dehydrogenase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00106 ) short chain dehydrogenase
  • ( pfam02036 ) SCP-2 sterol transfer family
  • ( pfam08659 ) KR domain
  • ( pfam13561 ) Enoyl-(Acyl carrier protein) reductase
  • ( pfam01370 ) NAD dependent epimerase/dehydratase family
  • ( pfam02882 ) Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
  • ( pfam13450 ) NAD(P)-binding Rossmann-like domain
  • ( pfam02737 ) 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003174409.997093137033517e-262acyl carrier protein reductase
SGDYKR009C3.9988176960464313e-94FOX2 SGDID:S000001717, Chr XI
from 457054-454352, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22293.0.g19(coding)
ATGTCTCAAGAACTTAGATTTGACGGTAAAGTTGCTATAGTCACTGGTGCAGGAGCCGGT
CTTGGAAGAGCCTACGCTCACCTACTTGCTTCAAGAGGTGCTAAGGTCGTCGTTAATGAC
CTCGGTGGTTCAGTTAGTGGAGAAGCTAGCAAGAACACTGCTAGACCTGCTGACGTCGTC
GTTGAGGAAATCAAGAAATTAGGTGGACAAGCAGTCGCTAACTACGATTCAGTTGAGCAT
GGAGATAAGATTGTTAAGACAGCAGTTGATGCTTTTGGCACTGTCGATATCGTGATTAAC
AACGCAGGTATCTTAAGAGATATTTCCATGTAAAAAATGACTGAGAATGATTGGGACCTC
ATCCAAAGAGTCCACTTGAAGGGATCATGGTCAGTCGCCAGAGCTGCATGGAACATCATG
AGAGAAAAGGGTTATGGAAGAATCATCAACACTTCCTCTTCAGCAGGTATCTATGGAGCT
TTCGGTCAAGCCAACTACGCAGCTGCCAAGCTTGGTCTCCACGGATTCACTCAATCCCTT
GCTAAGGAAGGCGAGAAACGTAACATTAAGGTCAACACAATTGCCCCACTCGCTGGTACC
AGAATGACCGAGACTGTGATGCCTAAAGAGCTCGTTGAGGCACTCAAGCCAGAGTACGTT
GCCCCAGTCGTCGCCTACCTCGTTCACGACACCTGCCCAGAAAGCGGTTCATTGTTCGAA
GTTGGTGCTGGTTATATCTGCAAGAATAGATGGCAAGCATCTGAGGGTGTTCTTTTCAGC
CCAGCTGAAATTTCCCCAGAGAACATTGCTAAGAACTGGAACAAGATCGTTGATTTCACT
CATGGAACATTCCCCACAGGAAACTAAGAAATGATGGAGAAGGTCATGAAAAATATTGAA
GCTGCCACTCAAGCACCAAAGACCGCACCACAAAAGGAATCTCCCAAGATTGACGCACCC
AAAGCTGCCCCAGCTCAACAAACCCCAGCTTCAACTGGAGCTGTACTTAAATCAGATGAA
ATCTTCGGTATGATGAAGACTTATCTCGATTAGGGACTCGGAAAACAACTGATTCCAAAG
GTAGCAGCAGTTTTCGCCTTTGAAATCCTTAAGACCAAGGGTGCCAAGGTCGAGGCCACC
TACGAGATCGATCTCAAGAACGGACAGGGAGACGTCAAGAAGGGCAAGCCAGCAAGTGCA
GATGCCACTTTCACCATGACTGACGAGGACTTCGAGGGAGTATGCATGGGCAAGCTCAAC
CCCCAGATGGCATTCATGCAAGGAAAGATGAAGATTAAGGGCAACATGGCCAAAGCCACC
AAGTTCACCCCTGACCTCTTCCCACCCCCAAATGCTGAGAATTTGGCCAAGTACAAGAGC
GCTAAGTTCTGA


>Contig22293.0.g19(protein)
MSQELRFDGKVAIVTGAGAGLGRAYAHLLASRGAKVVVNDLGGSVSGEASKNTARPADVV
VEEIKKLGGQAVANYDSVEHGDKIVKTAVDAFGTVDIVINNAGILRDISMQKMTENDWDL
IQRVHLKGSWSVARAAWNIMREKGYGRIINTSSSAGIYGAFGQANYAAAKLGLHGFTQSL
AKEGEKRNIKVNTIAPLAGTRMTETVMPKELVEALKPEYVAPVVAYLVHDTCPESGSLFE
VGAGYICKNRWQASEGVLFSPAEISPENIAKNWNKIVDFTHGTFPTGNQEMMEKVMKNIE
AATQAPKTAPQKESPKIDAPKAAPAQQTPASTGAVLKSDEIFGMMKTYLDQGLGKQLIPK
VAAVFAFEILKTKGAKVEATYEIDLKNGQGDVKKGKPASADATFTMTDEDFEGVCMGKLN
PQMAFMQGKMKIKGNMAKATKFTPDLFPPPNAENLAKYKSAKF