Identifiers and Description

Gene Model Identifier

Contig22101.0.g33

Standard Name

None

Aliases

Contig22101_0_g33

Description

Spc97 / Spc98 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004261601.9999987447608204e-178Spc97 / Spc98 family protein
SGDYHR172W0.0000000000599805963605737SPC97 SGDID:S000001215, Chr VI
II from 448335-450806, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22101.0.g33(coding)
ATGGATGTGTACAAGGGAGAAGAATTAATTATCTTGAAATTTGAAGATAGAGACTCCAAG
GATCCAGTAACTTTCGGATCTTCAATTTGTCTATAAACACCTTAAGGCTACTTCTTATCC
TTCAATAGTAATGGCGAGCTTAAAGTTGAGAAGAACATGAATTATGATGTACACAACAAC
TATATTGCTAAATTGACAAAGTGGAATATATACGATCACAAAAACACCAATAATACAAGT
ATAGTAACACCATTTGACGATATAGTTTTAAAATCACCCTTTGGAGAGTACTTTTAGGTT
TAGAATAATGAAGTTATCGGGGCAAACGGAAAAGAATCAAATGAAAATTGTGTTTTTAAG
ATAGTCAAAGCTGGCATACCTTTTCTACCAGACTGGATATTTAAAAGACCGCATTTAAAT
CATAACAATATTACGAGCTAATATCAAGGATTCTTGCAACAAAATCAAAAAGTTAAGTAA
GAGGAGAGACCTAAGAGTTTGGGAAGCCACCCGGTTGATATACAAAAAGTTCTGATAATA
GAGGATTTGCTTTTTGCTATGAGTAACATAGAGGGTGTTTATATCAAGAGAAAACAAGTA
TAAACTTTAGATGGATCATTTAGATCAGAGTTTTAAATTGAACCCTATCTACCATAACCT
ACAGCTGATTTTTCACTCTAATTCTCGGTCAATAAAATGCTTCCTCTTTGTAACAATCAT
GACTTAATTTAAGAGTTTATAAACGTTCATTCTTAATTCGAGTTCGGTTTAGTATCTCAC
GCTCTTTGTGATGCAATCCGTATTCTAATGAAGGAATACCTCTTGTTGGTGGTATAGCTA
GATACTGAGTTCATGAAATCAGATCCCCCTCTCACACTAGAGTAAATCTGGTTTTATATA
TAAAGTTCTCTAACAATTATGGAAAACTTGAAAAGACTTACTCAAGAGGCTGGAAATAAA
AAGGGAGGAGCACTTTTGAATGTCATTTACAGATTAATGATTAATAGCAGTGACAAATAA
ATTAGAGACTTGTTTAATTTCTTGCTTGAAAAAAGTGCACTGCCCTATTTCTCTATTCTT
AAGAAATGGATTTTCTAAGGTATTCTTGATGATCCATTTTAAGAATTTATTGTAAAGGAG
AACAAAAGCTATAGCAAGGAAAATATTGAAAAAGATTTCAATGACTAGTATTGGACTGAA
AGATTTACATACAGAGATGAAATGGTGCCAATTTTCTTAGCAAAATACAAAGAAAAGGTT
ATGCATTCAGGCAAATACCTTAATGTTATCAGGGAATGCGGAAAGGATGTTAAATATCCA
TATGAATAAGAAAACTTGCTAAGAGGTGTCCTTCCATCAGCCTCATAAGATGAAGAAATG
AAAGACACAGAAATGTTATTGAATAATGGAAGATTCCAAAATCAAATGAATCAAGGTGCT
TAAAGCCAATAATTTGATTTCTACGAGCCTATAGAGAAAGCTTATGAATGGAGTTCTCAA
TAACTTCTTCACCTAGTATTTGTTGAGTGTTAATTCCTTAAAAGACTAGAATCACTGAAG
CACTACTTTTTCTTAGATAGAGGAGATTTCTTTTTGCATTTTGTTGAAGGCTCAGAGGAA
ATCTTGGAGACTCAGACTTCTTAAATGACTATGGAAAAATTGGAGAGTTATCTTGAAATG
GCGATCAGAACCTCATCTGCAAATGCTGATCCCTTTAAGGACGATGTTACTTGTGAATTG
AACTCTTATGGGTTAATTGAGCAACTCTTTGCCATCAGAAATATCAGAGGGGCTCTTGGT
TAAAATGCAGGCATCAATAATAACAACTTAAATCAACAATTCGACTTTAAGCCAACTGCA
AAAACATTGAAAGTCTTGGAAGCCTTCACTTTGGATTACAAAGTTAAATGGCCTTTGACT
CTAATCCTCTCAAGAAAAACAATCACAAAGTATCAATTAATCTTCAGACATTTACTTTAC
TGCAAGTATGTTGAGAGAAATTTGGACTTAGTCTGGTCTCATCACTAATCTACGAAAGAA
TTTAACGTTCATGGTATTCTACAAAGAACTTACCTCTTGAGACATAGAATGTCTCAATTT
TGCAAGAATTACATTTACTATATGGTAGTTGAGGTCCTTGAGCCAAATTTCCACAGATTC
AAAGAAAGTCTTAAGAAAGTTAAAACCATAGATGAGATCCTTCTCCTCCACAATAACTTC
CAAGATGAATGTCTGAAAGAATGTTTGTTGACAGACCAGAACTTATTCAGAATTTTGACA
AAATTGAATCAAACTATCCATTTCTTCAGTAGAATTATCTTTAGGTTCTTTTAGTCTTTC
CAGTCTGATGAGGCTTTGTACATGGCTGAGGCTCAGGAAGACAATTATCATGGCAGAGGC
AGGATGTATGACGATGACGAGAACGACTTAAATGATAATTTTGATGCTTAATATTTGAAA
CGCAGACAAGACAGGATAGGCAAAAAAACAGAAAACATAAGGTCCTCAATTTTGGAGTAG
GGCTATCAGAGAATGGTCGATAAATTCCAATCAACTTTCGACAATCACATCAGAGAACTC
ATCTAGGTACTTACTCAGAGCAAGAGATACGAAACTCACATTGCTAATTTAGCAACTAGA
CTTGACTATAACGGATATTACTCAGAGAAATTCGCTCAAGAAAATCAGATTATATTATGA


>Contig22101.0.g33(protein)
MDVYKGEELIILKFEDRDSKDPVTFGSSICLQTPQGYFLSFNSNGELKVEKNMNYDVHNN
YIAKLTKWNIYDHKNTNNTSIVTPFDDIVLKSPFGEYFQVQNNEVIGANGKESNENCVFK
IVKAGIPFLPDWIFKRPHLNHNNITSQYQGFLQQNQKVKQEERPKSLGSHPVDIQKVLII
EDLLFAMSNIEGVYIKRKQVQTLDGSFRSEFQIEPYLPQPTADFSLQFSVNKMLPLCNNH
DLIQEFINVHSQFEFGLVSHALCDAIRILMKEYLLLVVQLDTEFMKSDPPLTLEQIWFYI
QSSLTIMENLKRLTQEAGNKKGGALLNVIYRLMINSSDKQIRDLFNFLLEKSALPYFSIL
KKWIFQGILDDPFQEFIVKENKSYSKENIEKDFNDQYWTERFTYRDEMVPIFLAKYKEKV
MHSGKYLNVIRECGKDVKYPYEQENLLRGVLPSASQDEEMKDTEMLLNNGRFQNQMNQGA
QSQQFDFYEPIEKAYEWSSQQLLHLVFVECQFLKRLESLKHYFFLDRGDFFLHFVEGSEE
ILETQTSQMTMEKLESYLEMAIRTSSANADPFKDDVTCELNSYGLIEQLFAIRNIRGALG
QNAGINNNNLNQQFDFKPTAKTLKVLEAFTLDYKVKWPLTLILSRKTITKYQLIFRHLLY
CKYVERNLDLVWSHHQSTKEFNVHGILQRTYLLRHRMSQFCKNYIYYMVVEVLEPNFHRF
KESLKKVKTIDEILLLHNNFQDECLKECLLTDQNLFRILTKLNQTIHFFSRIIFRFFQSF
QSDEALYMAEAQEDNYHGRGRMYDDDENDLNDNFDAQYLKRRQDRIGKKTENIRSSILEQ
GYQRMVDKFQSTFDNHIRELIQVLTQSKRYETHIANLATRLDYNGYYSEKFAQENQIIL