Identifiers and Description

Gene Model Identifier

Contig22093.0.g31

Standard Name

None

Aliases

Contig22093_0_g31

Description

Alpha amylase, C-terminal all-beta domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02806 ) Alpha amylase, C-terminal all-beta domain
  • ( pfam02922 ) Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
  • ( pfam00128 ) Alpha amylase, catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_014356709.997093137033517e-262Alpha amylase, catalytic domai
n containing pr...
SGDYEL011W9.997093137033517e-262GLC3 SGDID:S000000737, Chr V f
rom 133120-135234, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22093.0.g31(coding)
ATGGAAGATTTCCTTGACACTATTGAGAAAAAAGTTGATCATCATCACGAAGAGCATTAA
AATATTGACCCTTTAGTTGATACTTAAATAGAATAAAGCATCACAATTTAATAATCAAGC
CAGATTGATTCATAAGCTTAGGTTTAGATCTAAGAAGAGATTAAAGTCTAGGTTCATAAT
GATAATAAGATTGATTAGCAGGCCTAAGATAACATAGATGTAGGCAAAAATAAAGAAGAA
ATTACATCCCAAACAATTAACTAAACTCAATAAGTTCCCCCTCATAAAATTCAAGATGCA
GGGTTGATTTCTAATAATATTGTACAGGCAGATCAAATTAAATAGCAAGTACATTTACAA
TAAGCAGAAGTTGTGAAGGATATTACTAATCAAAAAAGAGATGCTCACCTAGGTAGTATT
ATGCAGGAGGAATAAAAGCAAATAGATCAGAAAATAAATCCAAAAATTCACCAATCACCA
CAAAAATAACAGCATGTTTAACAACATAGAAAAGAATTTTACGCAGTGATTGATGACGAC
CCTTATCTTAAATAATTTGAGCATGATATCAACTTGAGAAGACTTAAATACTTGTCATGG
AAAGAATAATTTGCTGCAGAAGCTGGATCATTTATCGATTTCACAAGAAGTTATAAGAAA
TACGGCTTGAATATCAATAAAAATGGAGATCTTGAGTATAGAGAATGGGCTCCAGCTGCT
AAAGAAGTCTCAATTTTTGGTGATTTTAATGGCTGGAATAGAGAATCTCATAAATTGACA
AGAGATGAATTCGGTCATTGGCATATAACCCTTCCAAAGAAAGCAGATGGAACACTCCCA
ATCTCTCATGAATCCAGATTTAAATGTTGTATTACAAAGGCAGATGGGCAAAAGGTAGAT
AGAGTCCCTGCTTGGACTAAATTTGCAAGACAGAATCCACAAAGTTTACTCTTTGATGCT
GTCTTCTGGAATCCTCCTAGCCCTTATGTAATCTAGAATTAAAGACCTAAGAAGCCTGAA
ACTTTGAGAATCTATGAAGCTCATGTTGGAATGAGTTCGATTGAAGGCAAAGTGAATACT
TATAGAGAGTTCGCCGACTTTGTCTTACCAAGGATAAAGGATTGTGGCTACAATTGTATA
TAACTAATGGCAATTTAAGAACATTCATATTATGCATCTTTTGGATACCATGTAACAAAC
TTCTTCTCAATCTCTTCAAGATCTGGCACACCAGACGATGTCAAATATTTGATCGATAAA
GCTCATGGTTGCGGTATCATGGTGATCATGGATTGCATTCACTCTCATGCATCTTCAAAT
GTTTTAGATGGCATCAGTTAGTTCGATGGTACGGATCATCTTTACAGCCATTCAGGAGCA
AGAGGAAAACACACATAGTGGGATTCGATGTTATTTGATTACTCAAAGTATGAAGTCCTG
AGATTCTTGCTCTCAAATATCACTTTTTACATGGAAGAATACTAATTCGATGGCTTCAGA
TTTGATGCAGTTACTTCAATTCTATACCATCATCACGGAATTGGAGTAGGATTTTCAGGT
GACTATAAAGAATATTTTGGTACTCATTGCGATATGGATGGAATAGTATACTTAATGCTT
GCAAATGATTTAGCTCATTCCATTTTTCCAGATGCAATCACAGTTGCTGAGGATGTCAGT
GGTATGCCTACTCTTTGCAGATAAGTCGATGAAGGCGGTTTAGGATTCGACTATAGACTA
AGCATGTTTATTCCTGATATGTGGATTAAAATGATGAAAGACTAAATGGATGAAGAATGG
AGTATGGGACATATAGCTCACAGTTTAACAAACAGAAGATGGAAGGAAAAATGTGTAGCA
TATGCTGAGTCTCACGATCAAGCTATAGTAGGTGATAAGACTTTAGCACAATGGCTTTTT
GATTCTGAAATCTACACTGGTATGGCCATAAACTAGCAACCTACAGTTCGTATTGATAGA
GGTATGGCTCTGCATAAAATGATTAGACTATTGACTTGTGGTCTTGGAGGAGAGGCTTAT
CTTAACTTTATGGGCAACGAATTCGGACATCCAGAGTGGATAGATTTCCCAAGAGAGGGC
AACGGCTTCAGCTATCACTACTCAAGAAGACAGTGGAACTTAAGTGAAAACCAAAATTTG
AGATATTTCTAACTCAAAAACTTTGATAGAGCTATGAATGAATTAGAAAGCCAATTTAAC
TGGATGGCAAGTGGTCACTAGTTTTTGACCTTAGCACATGAAGGAGATAAGTTAATTATT
TTCGAGAGAGGTGACCTCGTTTTCATTTTCAACTTCCACCCAACAAACAGTTATGAGCAC
TACAGAGTGGGAACAAATTGGGCCTCAGAGCATGTAATTTTAATGGATTCTGATTCATGG
TCATTCGGTGGACATAATAGATTAGAACCTGCCACAAGAAAGCTCTTTTTCCCTATTATC
AGAGAGTAATGGCAAAACAGAAGAAACTTCATTCAGTTGTATATCCCAAGCAGGACAGCT
ATAATTCTATGTGCAGAAGAAAACCTAGCGAAAAGAAGAATCTAAATAAATGGTAGACCT
AAAGTACTGCCTGCTTTAGAGGAAGTTAAGGTTTAAGAGACAATCTCATAAAATACTTAA
CCATTAGCATAAACTTAGGGCTTAGTCGATAAAATCGAAATGTCAGCAACAATTGCACCT
AAATTAGTTGGATCATAAGAGGAAACTATTGCTTAAGTTGGAGCTAATGTGGTAGCACAG
GACCTTTCAAGTAAACTTGACTCCGCAACAAAGCTTCTTTGA


>Contig22093.0.g31(protein)
MEDFLDTIEKKVDHHHEEHQNIDPLVDTQIEQSITIQQSSQIDSQAQVQIQEEIKVQVHN
DNKIDQQAQDNIDVGKNKEEITSQTINQTQQVPPHKIQDAGLISNNIVQADQIKQQVHLQ
QAEVVKDITNQKRDAHLGSIMQEEQKQIDQKINPKIHQSPQKQQHVQQHRKEFYAVIDDD
PYLKQFEHDINLRRLKYLSWKEQFAAEAGSFIDFTRSYKKYGLNINKNGDLEYREWAPAA
KEVSIFGDFNGWNRESHKLTRDEFGHWHITLPKKADGTLPISHESRFKCCITKADGQKVD
RVPAWTKFARQNPQSLLFDAVFWNPPSPYVIQNQRPKKPETLRIYEAHVGMSSIEGKVNT
YREFADFVLPRIKDCGYNCIQLMAIQEHSYYASFGYHVTNFFSISSRSGTPDDVKYLIDK
AHGCGIMVIMDCIHSHASSNVLDGISQFDGTDHLYSHSGARGKHTQWDSMLFDYSKYEVL
RFLLSNITFYMEEYQFDGFRFDAVTSILYHHHGIGVGFSGDYKEYFGTHCDMDGIVYLML
ANDLAHSIFPDAITVAEDVSGMPTLCRQVDEGGLGFDYRLSMFIPDMWIKMMKDQMDEEW
SMGHIAHSLTNRRWKEKCVAYAESHDQAIVGDKTLAQWLFDSEIYTGMAINQQPTVRIDR
GMALHKMIRLLTCGLGGEAYLNFMGNEFGHPEWIDFPREGNGFSYHYSRRQWNLSENQNL
RYFQLKNFDRAMNELESQFNWMASGHQFLTLAHEGDKLIIFERGDLVFIFNFHPTNSYEH
YRVGTNWASEHVILMDSDSWSFGGHNRLEPATRKLFFPIIREQWQNRRNFIQLYIPSRTA
IILCAEENLAKRRIQINGRPKVLPALEEVKVQETISQNTQPLAQTQGLVDKIEMSATIAP
KLVGSQEETIAQVGANVVAQDLSSKLDSATKLL