Identifiers and Description

Gene Model Identifier

Contig22056.0.g49

Standard Name

None

Aliases

Contig22056_0_g49

Description

50S ribosome-binding GTPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004556505.000729663236884e-95conserved hypothetical protein
SGDYER006W6.996603630663804e-52NUG1 SGDID:S000000808, Chr V f
rom 162723-164285, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22056.0.g49(coding)
ATGCCCAAACATATAGGTCGTGAGCCAACTGGTGACAGATATAAGTAAAAGTAAAAGCAT
GCCATTCAAAAGCAGGCAAAGCAGGATCTAAAATCTTTGAGAAAGGATGCTAAATAAAAG
AAAGCTATGGGCATGCAACCAGTCAAACTAAGGAAAGACATGGGATTACCAAACTTAAAA
ATTTAGAAGCAAGAATTGTTAGATTAGATTGAGCGCAAGTAAAGAATGGATTAGCAAACG
AGGGAACATATGACAAACATCTAAGAAAAGAGAAATGGATTAGATATGGCTCAGTACTTA
TCAAAAGTTTAGACTCAATAAAATCAATATGAAGAAGTAAAGAAGTACGAGACCGTCAAT
AATGACGATGGAATGGTAGATACCGATCCAAATGCAAGATCTATGAATTAAAGTAAAAAG
GCATATGCAAAAGAGTTGAAGAAAGTTATCGAAGCATCCGATGTTATTATTGAAGTATTA
GATGCTAGAGATCCAGAAGGATGCAGAAGTCATGAAATGGAGAAAGAAATTCTCACAGCT
GGCAAAAAGGTATTGCTTGTTGTAAATAAAATCGATTTGGTTCCTCCTCAAAATGCCAGA
ATGTGGCAAAGACATCTTAGAAATGAATTCCCTTGCTTATTGTTTAAGACAAATCGTCAA
AATCAAGATAATTTATCAATGGGCACGGCTCTGCATAAAAATTCAATGTTAAATAACTCT
AACCTTGTTGACTCTATGATACATACATCTAAAGCAGTTGGAACTGATAATCTCATGAAC
ATTCTTAAGAATTATGCAAGAGTAGAAGGTGGAAATGGAAAAACCAAGCAATAAATTACC
GTAGGTGTAGTCGGCTTCCCTAATGTTGGAAAATCTTCATTGATTAATTCTCTCAAACGT
TAGAGAGCTGCTGCTACAGGCAACATGCCAGGAGTGACTAAAGCAATGCAAGAAATTTAA
CTTGATAAGAACATCATTTTGATTGATTCCCCAGGAGTCGTTCTTTCAACAAAGGATCAA
AGTGATTCCCTAATTTTGAGACAAGCCATCAAAATCGAAGACATTACTGATCCATTCAGG
CCTGTTGAGGCAATTATGAACAGAGTTGACAATACTGAACTACTTGCTTTCTATGGTATT
CCTCCTTACAAGAGCACTGATGAATTCCTTGGTTCAATTGCAAGGTTGAAGGGATACTTG
AAAGCAGGAGGCATAGCCAATTTTGATTAAACAGCAAGATCAGTTATTAGAGATTTCCTT
AATGGAAAGTTAAAGTATTTCACTGCACCACCAGCTATGGAGGGCGAGGATATGGACGAA
GATGGGGACGTAGAAATGGAATGA


>Contig22056.0.g49(protein)
MPKHIGREPTGDRYKQKQKHAIQKQAKQDLKSLRKDAKQKKAMGMQPVKLRKDMGLPNLK
IQKQELLDQIERKQRMDQQTREHMTNIQEKRNGLDMAQYLSKVQTQQNQYEEVKKYETVN
NDDGMVDTDPNARSMNQSKKAYAKELKKVIEASDVIIEVLDARDPEGCRSHEMEKEILTA
GKKVLLVVNKIDLVPPQNARMWQRHLRNEFPCLLFKTNRQNQDNLSMGTALHKNSMLNNS
NLVDSMIHTSKAVGTDNLMNILKNYARVEGGNGKTKQQITVGVVGFPNVGKSSLINSLKR
QRAAATGNMPGVTKAMQEIQLDKNIILIDSPGVVLSTKDQSDSLILRQAIKIEDITDPFR
PVEAIMNRVDNTELLAFYGIPPYKSTDEFLGSIARLKGYLKAGGIANFDQTARSVIRDFL
NGKLKYFTAPPAMEGEDMDEDGDVEME