Identifiers and Description

Gene Model Identifier

Contig22038.0.g106

Standard Name

None

Aliases

Contig22038_0_g106

Description

Peptidase family C54

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005262702.9990874792167046e-33Peptidase family C54 containin
g protein
SGDYNL223W0.00000000000020009182674645818ATG4 SGDID:S000005167, Chr XIV
from 227370-228854, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22038.0.g106(coding)
ATGGAGAAGAAAATTTAATCACTAAAGCCACAGTAAAGAGTAATTGGTGGTCCCAACGGA
GCTTCAAGAAGAACAAATTAAGCAAAGTATAATCTTGAATAGCATGAATGTTCAAATGCT
AATGATGATGACGAGGGGAACTTAAACAATTTCCAGATCTATGACGCTCTGTAAAAATAA
ATAACTGATGGGACTCAGCTTATGCCAGGAAGCACTAGTTCTGTTGTAATTGTTTAAAGC
ACCAGAGAAAGTTAAATTAGCAATAAAAGTAGTAACTCAAGATCCCCACCTACCCTCTCT
GCAAAGATTAAGGCCAAAGAGCTCAACTAGCAAATTCCTCCCAAATAAATTAGCAATGCA
AGCAATAGGAAGTTAGGACAAGAATAGTAGAATTCCTCCATTGGTCATATAGAGAGATCG
ATTATAAATCCATCTACACTCATAAAACTGAATAAAAATCATGCTGAGGACGAGCAATTC
TTTGATCATACTTATGAGAGAGGGAAAAAGAGATCACTTACAGATGACAAAATGTTTCAA
AACAACTAAACAGTTGAAAACGATGAAATCGATAAAACTCCTAATGAGCTTTTCTCACAA
ATAAATAGTAAAGAGTTGGGTGGAAGTACAAATGACACTAGCTCAAATTAAGGCTAGTCT
AAGAACTTGTTCTAAAGACCTTATAGGATTAAATCAAATAACTATTCTGATGTCAACTCA
GACGACTATTTAGAAAAGAAAGAGCCTATAAATATGGTGTCAAATTAACAATATCACTAA
CCTTAACAGTTTGTGATCGCTGATTATTAAGATTCAGAATTCTAAAATAATGATGCAATC
TAGACTCCCTCTTCCTCCACTTAAAAATAGAAATCTCCTGAAAATAAAGATAAAGAGGGA
TAAGCATCATATTATTAATACTGGGTCAATAAGGGCATAAATTATAAGTATAAAATGCCT
TGGAGTACCTTAGCAAAAGTGTTCACTGAATATTAATAAGTCACCTTTGAGCCAAAAGAT
CTGCCTCTTATATTGCTAGACAAACTTTGGGAGGATACTAATTTAGGCAAAAACTTTTAG
AAATAGAAGAATTTTCTACCTCTACTCACAGAAAATAAATATATTTCAGATTCTGTTATG
TAAAAGAGGCCAAATGAAAACTTTAACAAAGTATTTACGACTACTGATGTAGGTTGGGGT
TGTACTATTAGAGTCGGATAAATGATGATATGTCAGGCTTTGATGAGGCATTTAATTGGT
CTTGATCATAGCGTCAAAAATTTAAGTTCAACTGAATAAAAAAGACTTAACTATGCAAAA
ATTATATAGCTCATTCACGATAACGATTGTTCATAAACAGGTGCATTTTCAATTTAAAAT
ATAGCTAAGATGGGATTTTGTCATGATAAGCTCCCAGGAGAATGGTATGGGCCCCATGCT
TTAACAATTATGCTTAGAGATTTGAACAGGATATACTAACCTGTAGAAAATTTTTAAGTT
TGTATGTTCAGAGATGGAAATGTCTATTACGATAAAATTATGAAGACAGCGATAACAGAC
GGAAAGGCATATCAAATTAAGAAAAAGGGGAAACCTATGTCGATGGATTAATGTGAAACT
ATCAACCGCATGCAGACTTAATTCCATAAGTTTCTAATAGATATAGGATATTATAATGAT
TTTCCTCTCTCAAGATACTAACATCATGATAAGAACAAAGAATTTGATAGTCCAAAGTTA
CATGACCGAGATTCCGATAGCTCTTTATAAGAGAGACTAGACATGATATATTAAGATCCT
GAAATCTTAAGATCAGCTTGGAGAAACGGCATACTAGTTATTATTCCTACTAGATTAGGT
CTAAACAAGGTAAATAAAGAGTACTATTCATCAATAAAGTATGTATTTCAATGCAGACTA
AACGTTGGTATAATGGGAGGAAGGCCTAACTAAGCACTTTACTTTGTTGGTACTTAAAAG
ACAGATCTCATCTGTTTAGATCCCCATCTTGTACAGGATACCGTTCTAAATTAAGAAGAG
CTCTCAAACGTGGAGCTAAACTAAACTTATCATTGTGATTAAGCTAAGAAGTTATCAATG
ACTAAATTGGACACCTCCTTGGCATTCGGCTTCTACTTGAAAGACTACAATGACTTTGAA
GTGTTCTAGGGCTTTATTGAGATGGGTTAGAAACTGTTTAAGGAAAACTGGGTCTTCTCA
ATCTTCAACAGAAAGCCAGATTATGGAAGATTTAGCGAAAGAGCCTCTGATAACTTTTAT
CTTCCAAAGACCACTCTAGGATTTGACCATGTAACTAACTATACTAAAAAGGGAAACTCC
AATATATCTTAAAATACTACAATGCTCACTATAAATCCAATTCCTTTAAACAAAAATAGG
TCAACGAATGTTCCTTAATCTAGAGGAATTGAGCTGGAAGAGGATAAAGACGATGACTTT
GAGCTTATATGA


>Contig22038.0.g106(protein)
MEKKIQSLKPQQRVIGGPNGASRRTNQAKYNLEQHECSNANDDDEGNLNNFQIYDALQKQ
ITDGTQLMPGSTSSVVIVQSTRESQISNKSSNSRSPPTLSAKIKAKELNQQIPPKQISNA
SNRKLGQEQQNSSIGHIERSIINPSTLIKLNKNHAEDEQFFDHTYERGKKRSLTDDKMFQ
NNQTVENDEIDKTPNELFSQINSKELGGSTNDTSSNQGQSKNLFQRPYRIKSNNYSDVNS
DDYLEKKEPINMVSNQQYHQPQQFVIADYQDSEFQNNDAIQTPSSSTQKQKSPENKDKEG
QASYYQYWVNKGINYKYKMPWSTLAKVFTEYQQVTFEPKDLPLILLDKLWEDTNLGKNFQ
KQKNFLPLLTENKYISDSVMQKRPNENFNKVFTTTDVGWGCTIRVGQMMICQALMRHLIG
LDHSVKNLSSTEQKRLNYAKIIQLIHDNDCSQTGAFSIQNIAKMGFCHDKLPGEWYGPHA
LTIMLRDLNRIYQPVENFQVCMFRDGNVYYDKIMKTAITDGKAYQIKKKGKPMSMDQCET
INRMQTQFHKFLIDIGYYNDFPLSRYQHHDKNKEFDSPKLHDRDSDSSLQERLDMIYQDP
EILRSAWRNGILVIIPTRLGLNKVNKEYYSSIKYVFQCRLNVGIMGGRPNQALYFVGTQK
TDLICLDPHLVQDTVLNQEELSNVELNQTYHCDQAKKLSMTKLDTSLAFGFYLKDYNDFE
VFQGFIEMGQKLFKENWVFSIFNRKPDYGRFSERASDNFYLPKTTLGFDHVTNYTKKGNS
NISQNTTMLTINPIPLNKNRSTNVPQSRGIELEEDKDDDFELI