Identifiers and Description

Gene Model Identifier

Contig22002.0.g104

Standard Name

None

Aliases

Contig22002_0_g104

Description

ATP synthase subunit C

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177
  • integral component of membrane (IEA) | GO:0016021

Molecular Function

Biological Process

Domains

  • ( pfam00137 ) ATP synthase subunit C
  • ( pfam11821 ) Protein of unknown function (DUF3341)
  • ( pfam03323 ) Bacillus/Clostridium GerA spore germination protein
  • ( pfam04829 ) Pre-toxin domain with VENN motif
  • ( pfam10766 ) Protein of unknown function (DUF2592)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006536201.0004671766404936e-76V-type ATPase, C subunit famil
y protein
SGDYEL027W6.001502944943701e-53VMA3 SGDID:S000000753, Chr V f
rom 100769-101251, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22002.0.g104(coding)
ATGGTACTCGCATTATTAGCATTAGCCGATGATCCAACCTCTGCCGACAGAGCTCAAGCC
ACCTTCTTCGGATATATTGGTATCGCCGCAGCCCTCGTTTTCTCAAACTTGGGAGCTTCA
TACGGTACTGCCAAGAGTGGTGTCGGTATTTCAAGCATGGGTGTCCTTAAGCCAGAGTTG
ATCTTCAAGTCAATCGTTCCAATTATTATGGCAGGTATCTTGGGTATCTATGGACTTATC
GTCTCCGTCATTCTTCAACAAAAAATCGTCGTCACTGAATACACCTACGACAAGGGTTAC
AAGCATCTTGCCTCAGGACTCTGTTGCGGTCTCTCATCTCTCGCTGCCGGTCTCGCCATT
GGTATTGTCGGTGATGCAGGAGTCAGAGCTAATGCCTAACAAGAACAGATCTTCGTCGGA
ATGATTTTGATTCTCATCTTCGCTGAAGCCTTGGGTCTTTATGGACTTATTATCGCTATT
ATCCTTTCTCAGTGA


>Contig22002.0.g104(protein)
MVLALLALADDPTSADRAQATFFGYIGIAAALVFSNLGASYGTAKSGVGISSMGVLKPEL
IFKSIVPIIMAGILGIYGLIVSVILQQKIVVTEYTYDKGYKHLASGLCCGLSSLAAGLAI
GIVGDAGVRANAQQEQIFVGMILILIFAEALGLYGLIIAIILSQ