Identifiers and Description

Gene Model Identifier

Contig21940.0.g53

Standard Name

None

Aliases

Contig21940_0_g53

Description

Pyruvate kinase, barrel domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012053006.001629673589058e-65Pyruvate kinase, barrel domain
containing pro...
SGDYAL038W1.999576471039937e-58CDC19 SGDID:S000000036, Chr I
from 71786-73288, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21940.0.g53(coding)
ATGGAAGATATACAACATAAAATCAGCTACATAGGTGGAGAAGGAGAATATGATGGACAG
AGAAAGAATGTGCAATCTAGAAACATTTCAAATATTGACTGGTTTAGACCTAAGACCCAG
GAAGATCCATCACAAGAGGCATTGAAGAATTATTTGAAGAAAATAAATTAAGAGTATAAT
CAAAATGAGTAATAAGGGGATAAGTAGAGGGATGATATTTTGTTCAGGAAGACTAAGATA
ATTTGCACACTTGGAAAATATACGAGAAACCTGGAAGCAATATGTAAATTGATTAAAGAA
GGTTGCCAGATTTTCCGCATTAACATGTCCATCCAGCAAAATAAAGATTTGAAGGAGTTG
ATTCAGTGGATACGCAGTGCAGAGAAAATTACCAAAACTAAAGTGGGGATTATGATTGAT
TTGCAAGGACCAGTCATCAGAACTTGTGAATTTAGAGCTATAAATACCCCTATTTTATTG
AAAGGAGGACAGGAGTATAGAATCCTTTGTAAGAGAAAGATAGCTGGAGATGAATCTTTC
GCAACAGTAGACTATAAAGACCTCGCCAAGAAAATAAAAGTCAATGATCATATTATTGCA
GATTTTGGCTCAGTTTGTATGCGAGTCATAGGCTTTGAAGACTAGCATTAGTTTTTAGTC
GGCAAGCAACTTGAAGGCGTTGATATGAACCCAGCACCCAAATAAGCAAGAACTAATAAG
ATGTCTTTGAGTTTTCAGGGTTAGAAAATAAGGCATCCTGATTTTTCTAAAAAATTTGCA
CCTCCTGATCAATCTCAAGCTACTATGCTGATGCCTTTAGCAAGTCCAGTAAGTTAAAGT
GCAGCCAATATACCTTTGGGTGGCTATCTAAAACAGTTCAGCAGAAGCAGAGCAGATACC
ATAGACAATGACTCCGAAGTGGATTAGATACAGTTAGACACTTCTGTTAAAGAGATAGAC
TTGCAACACAATTCACAAGAAAATAAAAACATGGATAGCAAAACATTCGGTACTTAACTA
GAGACTGTAATTGAAGAGGACAAACCTTTCTAAGAGAAGAAGAAATTCAAAGTCCGCTTT
GATGACGTCTATGAAGCTAATCACATTGAGAAGTCGAGGGTAGAGAAGGAATTCTTTGAA
AATGCTATTAAAAACAAAAGATATGGTGGAAATAAACAAATAAAGTCTCAGAAATTTGAA
GATAATCTTAAGCTAGATGACTCTCCACTGAGAGGAGGTTAGAAAGAGAGCAACAACCTC
CAATCCCAAAACATTTCCAATAATTTCGCTAATTATTCCTTAGAATAACAATAGGAGTTT
TTTAAGCAGCCACCTCACAAAAGTCAGACGCTTATTTCACCAAATACAAGCAGTAGAGTA
GGGGGAAACTTCCCAGAGTTGTCTGTGATCTAAGAGGAGAAGAAAGTCGATTCAAATTCC
AAAATAAATTTCAATATTTCATCACTGGATTAAGACTAAATTGCAAACGCTGCAGAATCT
TCGAAGCCATTGCATTAGTCTGATAAGTCCTTGGTTTTATTCGCTGGAAAGTAAGACAAT
ACTAGTTTGGGTAGAACTTCTGGAGGATTAAAAACAGTAGGATCCGCACTTAACATACAA
GGCTAGCAACACCAAGAAAACGATCTGGGAGGGTTGCCAAAACGTGGTAGTCAACTCTCA
CTAAGAAATCGTAAGAAAAGAATTATTAAGAAAGACAAGAAAGTCATTATCTGCAAAGTA
GAATTTGATTGTGAGATTAAACCTCACAAACCACTTTATTTCCCAGATTTCGATCATAAA
AATGAATTTGAAATGTCTGTGGTCACTCAAAAAGATGTCTTAGATATATATTCATGCATT
AAACTAGGAGTAGACTTTATTTCTGTCTCCTACGTTGAATGTAAATAAGATCTTCTAGAA
GTCAAGGAGCTGTTAAGTATTAAAGGAAGACACATAAAAATAATTGCAAAGATATAGAAT
CGTAAAGCTATCGAAAATTTTTAAGAGATATTAGAAGCTGCAGATGGGATTATTATAGCT
AGAGGGTACTTGGGCTTGGATTTAAAGCTAGAGGATGTAGCATTTGTACAGAAATATCTT
ATAAAATAGTGCAATTTAGCTGGTAAGCCAGTAATTTTGTCAACTTAAATCATGGAAAGT
ATGGTGAGTAGATTGAGACCTACAAGAGCAGAAGTATCAGATATATCGAATGCAGTATTT
GACGGTGTAGATTGCTGTCTCTTGAGTAGTGAAACTCAAACTGGGCCCTTTTACAAAGAA
GCTTGTGAGACTATGTCTAAGATTTGTTATGAAGCCGAGAAGCACATTGACTATGAGAAG
AACTATATAGATCTGTAGAAGATGATATTTGACTAGAATTTGACACTATCTATTGGTGAG
GCTATCTCAAATTGTGCAGTTAAGGCTGCTTATGAAATTAATGCTAAGTTAATTATAGTC
TTTACTAATAGTGGACAGTCGGCTATTACAGTTTCTAAATACAGACCATAATGCCCCATT
CTTGCAGTTTCTGCTTCTGATAAATCAGCAAAGCAATGCATGATATCCAAGGGCATCTAT
ACATTCCTAGTTGGCTCTCTGATTGGTGCGGACAGTCTCCTCGACAAAGTAAAGAAAGAA
GCCAGCAAGCGCGGCCTAATCAAGGTTGGTGATTATATAGTGGTAACCACTGGAATAAAC
GAGGGGTTAGAGGGAAGTACTAACTTACTCAAAGTACTCCAAGTATGA


>Contig21940.0.g53(protein)
MEDIQHKISYIGGEGEYDGQRKNVQSRNISNIDWFRPKTQEDPSQEALKNYLKKINQEYN
QNEQQGDKQRDDILFRKTKIICTLGKYTRNLEAICKLIKEGCQIFRINMSIQQNKDLKEL
IQWIRSAEKITKTKVGIMIDLQGPVIRTCEFRAINTPILLKGGQEYRILCKRKIAGDESF
ATVDYKDLAKKIKVNDHIIADFGSVCMRVIGFEDQHQFLVGKQLEGVDMNPAPKQARTNK
MSLSFQGQKIRHPDFSKKFAPPDQSQATMLMPLASPVSQSAANIPLGGYLKQFSRSRADT
IDNDSEVDQIQLDTSVKEIDLQHNSQENKNMDSKTFGTQLETVIEEDKPFQEKKKFKVRF
DDVYEANHIEKSRVEKEFFENAIKNKRYGGNKQIKSQKFEDNLKLDDSPLRGGQKESNNL
QSQNISNNFANYSLEQQQEFFKQPPHKSQTLISPNTSSRVGGNFPELSVIQEEKKVDSNS
KINFNISSLDQDQIANAAESSKPLHQSDKSLVLFAGKQDNTSLGRTSGGLKTVGSALNIQ
GQQHQENDLGGLPKRGSQLSLRNRKKRIIKKDKKVIICKVEFDCEIKPHKPLYFPDFDHK
NEFEMSVVTQKDVLDIYSCIKLGVDFISVSYVECKQDLLEVKELLSIKGRHIKIIAKIQN
RKAIENFQEILEAADGIIIARGYLGLDLKLEDVAFVQKYLIKQCNLAGKPVILSTQIMES
MVSRLRPTRAEVSDISNAVFDGVDCCLLSSETQTGPFYKEACETMSKICYEAEKHIDYEK
NYIDLQKMIFDQNLTLSIGEAISNCAVKAAYEINAKLIIVFTNSGQSAITVSKYRPQCPI
LAVSASDKSAKQCMISKGIYTFLVGSLIGADSLLDKVKKEASKRGLIKVGDYIVVTTGIN
EGLEGSTNLLKVLQV