Identifiers and Description

Gene Model Identifier

Contig21752.0.g20

Standard Name

None

Aliases

Contig21752_0_g20

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam09770 ) Topoisomerase II-associated protein PAT1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000792309.997093137033517e-262hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21752.0.g20(coding)
ATGGCAGATCAATTCACCTACCAAAAGAAGAGAAAGGAGTTCGGACGTCACGCTTAGTTC
GAGGACACCGAGACCAAGATAGTCGGAAGTGTCATTCCTAATCACTAGCAGAAGGAAATC
TACTAGCTCAGAGATCCTAACAAGATTATCTTTGATAATATTCCTCAATTTTCTGAACAT
AGAGTTAACACTGAGAGAGTTGCCACCAGTAACAGAGGAATGAAGCATGTAGTTGGAGGA
TGGCCAAAGGATTACGATTACACCGAAGTGGGAGATGTATAAAAATATCAAAAGAAGTTG
AACAGAGACCCAGCTCTAGGTTTCGGACAGGCCTCTAAAGATCTGGTCGCAGGAGCCCAA
AAATGCATTAGACAGAATAACGAGATCGATCTCTTCGAAGAGTACTTTAGCGGTGAATAG
CCCGAGCACTTATCAGAGACTATCTCAACCAAGACTGTCATGATTTTCAAGGATCCTAAC
CCAGTTAAGAGAGCAGTTACCAAGATCGCTTGGCACCCTGAGTCTACCACAGACTTAAGG
GTCGGTGTTGCTTACGCCATGCTAAGGTTCTAGTAAATGCCTCCCAGAATGCCTTTGAAT
TCTTATATTTGGAATTTAAACAACCCCAACTTTCCCGAGAGAACACTTTAACCACAATCT
GCTCTATGCACTATGGTTTTCAATCCCAAAAACAGTGAAGTCATTGTCGGAGGTTCCTAC
AATGGTTCTCTTGCATTCTTCGATCAGAGAAAGGGTAGCTCAAACGGTGTGATTAAGCCA
GCTGAAACAACACTTTTGGAGAAGTCTCATCATGATCCAGTTTACGATATTTACTGGCTT
GTTGGTAAGACTGGTACCGAATGTGTCTCAACCTCCACTGATGGTAGATTATTGTGGTGG
GATATGAAGAAACTAGGAGATGGTCCAGTTGACGAACTAGTTTTGAGTGAATAATTCTAA
GTAAACGACTAACCTGTGACTAAGATCCTCGGAGGTACAAGTCTCGAATATAATCAGGAC
GCTGGTCCACTCAAGTATCTCATTGGTACTGAGCAAGGTTACATCCTTCAAGCTAACAAG
AGAAAGGCAGTTGAAATCTAAACTCGCTTTGGTATGGAATCTGGAAAGCATCACGGTCCA
GTCTACGCCTTGCAAAGAAATCCAGCTCACACCAAGTTCTTCATGTCAGTTGGTGATTGG
ACTGCCAAGATCTGGTCAGAAGAGCTCAAGACCCCAATCATGCAAACTAGATATCACAAC
TCTTATTTGACAAATGGATGCTGGTCACCAACCAGATGTGGCCTCTTCTTCCTCACAAGA
ATGGACGGTTTCATGGACGTTTGGGATTTCTACTATCGTCAAAATGAAGTAGCTTACTCT
CAAAAAATCTCTGATTCACCACTCACCTCAATTTCAGTCATGTAATCTATGGCTGCTATT
GGTGATGCAGAAGGTACTGTTTCAATGATGAGTTTGTGCAGATCCCTCTACGATCAGACC
ATATAACCAGAGGAAAAAGCAGTAATGGCCTCAATTTTCGATAGAGAATTCAAAAGAGAG
AAGAACTTGGAGCAAGCCAAGAGACAGGCCGACATGAAAAAGCCAGTCAAAAAGGACAAT
TCAGTATAAGACAAGAAAGTTGAGAAGATGAATCAGATGCTCAATGACTTGGAGGAGCAA
TTCTTCAAGCAAGTGGCTGAGGATTAAGATGCACTTGCTACCATTAAGCAACGTGGAGCT
CATCTAGATGATCACTCTAATGGTCATGCTCAACCTAAGGCATAACCAAAGGAGGAAGTC
AAACAACAACAGCAACCAGCTGCCCAGTAGTAAAAGCCAGCTGCTCAACAACAACAAGTG
CCTCAGCAGTAGCATTAATAGTAAGTGCCAGCTCAACAACAACCACCCGCTCAGCAACAT
TAAGATGAGGAATAACATCACTAACAACAGCCACATCACGAAGAGAAGCCTGCACATAGA
CAAGAAACTCCAGTGAGGACACCATCTCAGCACTCTTAACAGTAAAATCAAGATGATGCT
ACATCGGCAGTTAACAAATCTCACCAAAATATACTTATTTTGCCAATCGGTACTCACACT
CTACAGGGAACTTATCAGAGAGCTGATGGAGAAAGTGTGGAATTACAGCTGACCGTGTAA
GTTGAGGAAGGCGGTTTCATTCAATTATCACAAGATGATCAAGACAGACTCGGCTACAAC
GTCAATGGTTTCCAACAAGACGCCACTATCTCATTCAAGGTACAGTTCGCTAATCAGAAG
GAGGTTGAATTCAACGGTGAGTTCGATAGCAATAAGTTAATTATCGGAGGATACAAAACA
GAAGCTGATGATAATTATGATGCAGAGGGTTCCTTCAATTTAGTGGTTCTTGATTGA


>Contig21752.0.g20(protein)
MADQFTYQKKRKEFGRHAQFEDTETKIVGSVIPNHQQKEIYQLRDPNKIIFDNIPQFSEH
RVNTERVATSNRGMKHVVGGWPKDYDYTEVGDVQKYQKKLNRDPALGFGQASKDLVAGAQ
KCIRQNNEIDLFEEYFSGEQPEHLSETISTKTVMIFKDPNPVKRAVTKIAWHPESTTDLR
VGVAYAMLRFQQMPPRMPLNSYIWNLNNPNFPERTLQPQSALCTMVFNPKNSEVIVGGSY
NGSLAFFDQRKGSSNGVIKPAETTLLEKSHHDPVYDIYWLVGKTGTECVSTSTDGRLLWW
DMKKLGDGPVDELVLSEQFQVNDQPVTKILGGTSLEYNQDAGPLKYLIGTEQGYILQANK
RKAVEIQTRFGMESGKHHGPVYALQRNPAHTKFFMSVGDWTAKIWSEELKTPIMQTRYHN
SYLTNGCWSPTRCGLFFLTRMDGFMDVWDFYYRQNEVAYSQKISDSPLTSISVMQSMAAI
GDAEGTVSMMSLCRSLYDQTIQPEEKAVMASIFDREFKREKNLEQAKRQADMKKPVKKDN
SVQDKKVEKMNQMLNDLEEQFFKQVAEDQDALATIKQRGAHLDDHSNGHAQPKAQPKEEV
KQQQQPAAQQQKPAAQQQQVPQQQHQQQVPAQQQPPAQQHQDEEQHHQQQPHHEEKPAHR
QETPVRTPSQHSQQQNQDDATSAVNKSHQNILILPIGTHTLQGTYQRADGESVELQLTVQ
VEEGGFIQLSQDDQDRLGYNVNGFQQDATISFKVQFANQKEVEFNGEFDSNKLIIGGYKT
EADDNYDAEGSFNLVVLD