Identifiers and Description

Gene Model Identifier

Contig21741.0.g7

Standard Name

None

Aliases

Contig21741_0_g7

Description

PCI domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005789403.998648822114894e-70hypothetical protein
SGDYDL147W2.9992141389250636e-57RPN5 SGDID:S000002306, Chr IV
from 190924-192261, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21741.0.g7(coding)
ATGGCACAACAGAGAGACCAAGAGAAGCAGCGCATGTTCGATATTGGCGCTGAAGAGATG
TGGACCCCCTTCCTTGAGGAAGTCAATGACCTTATGATTGAAGAGAAGGCAGCTAGACAT
GAAAACGATGGTATTAAAACTTCAGAGATTTGCCTTAGAATTTTAAGACTAGCATGGGAC
TAGAGAGACTTGGCTCGTCTCCGTGAGTTCTTGATGATCTTAACCAAGAGAAGAGGTCAA
GGCAAAAAGCCCATTGTTGACATGGTTTAATTGCTCATCAATGAATTCTTGCCCAAGTTG
CCAAACAGAGAAGAAAAGTACAACATGCTTCAAACAATCAGAGACGCTTCAGATGGAAAG
ATGTTCTTAGAAAGAGAGTTTGCTTAAAGCATAAAGTGGCTGTGCGAGATGCTCGAGGAA
GACGGCAAGGTTGATGAGGCTACCAAGATTATTCAGGAGATTCAGATAGAAACATATGGA
TCATTGTAAACTTAAGAGAAAGTTGATTTCATTCTATACCAAATGAAACTTGTTTTGCTG
AGAAGAGATTTCGTAAGATGCCAAATTCTCTCACGTAAAATCTCCAGAAAGCATTTGAAT
GAGGCAGGACTTGAGAAACAAAAGGTCTAGTACCACCATTTTATGATCCAGTACTACGTC
CATGAGAAGATGATCCTTGACACTGCCAAGTCTTATCAAACCATCTATGACACTTACAAT
AAAAGCGATGCAGCTCTTAACTTAGATCCCACTGGCGAGCTTAAGGCAGTTGCTTTCCAA
AACTTCATCATTTACTTGATGGTTGGTCCCTACTCAAATGAGAAAGTTGATCTCCTTAAC
ATTGCTGATCAATTATACTCAAGAGAACTTGACTAGCACGAATTAATTGCTCGCTTCATG
AGAAAGTTCTTGAGCTATGAATTGTTGCCATTCAACGACCAAGAAATCGAGCAGAGCTTT
TCACAGTTTGAGCCATTCACCGCATCTAAGACTGAGCATGCTCAATTACACATGCAAGAT
TTCTTGCGTTAACTCATCCAACACAATATCAGAGTGATTTAAAAGTACTACCAGAGAATA
AAGTTGAACAGACTTGCTAATCTTGTAGGAGTCTCAACTGACTTGGCAGAAACTGAAATT
GGAGATATGGTTGTTAACAAGAGACTCGTTGCAAAGATCAACAGAATGCAAGGCATTGTC
TCATTCCAAAAGAGCAAGTTCACTAACGATGTCTTAAACGACTGGAACTACGACATCAGA
CACATGTTGGATAAGATTGAAAACACTTGCCATTTAATCAACAGAGAGAAAGTCGTTCAC
AATGTTCTATGA


>Contig21741.0.g7(protein)
MAQQRDQEKQRMFDIGAEEMWTPFLEEVNDLMIEEKAARHENDGIKTSEICLRILRLAWD
QRDLARLREFLMILTKRRGQGKKPIVDMVQLLINEFLPKLPNREEKYNMLQTIRDASDGK
MFLEREFAQSIKWLCEMLEEDGKVDEATKIIQEIQIETYGSLQTQEKVDFILYQMKLVLL
RRDFVRCQILSRKISRKHLNEAGLEKQKVQYHHFMIQYYVHEKMILDTAKSYQTIYDTYN
KSDAALNLDPTGELKAVAFQNFIIYLMVGPYSNEKVDLLNIADQLYSRELDQHELIARFM
RKFLSYELLPFNDQEIEQSFSQFEPFTASKTEHAQLHMQDFLRQLIQHNIRVIQKYYQRI
KLNRLANLVGVSTDLAETEIGDMVVNKRLVAKINRMQGIVSFQKSKFTNDVLNDWNYDIR
HMLDKIENTCHLINREKVVHNVL