Identifiers and Description

Gene Model Identifier

Contig21523.0.g45

Standard Name

None

Aliases

Contig21523_0_g45

Description

Adaptor complexes medium subunit family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00928 ) Adaptor complexes medium subunit family
  • ( pfam01217 ) Clathrin adaptor complex small chain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011086205.001468883219942e-179Adaptor complexes medium subun
it family protein
SGDYPL259C5.999005845715319e-148APM1 SGDID:S000006180, Chr XVI
from 52671-51244, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21523.0.g45(coding)
ATGAGCGGATTAGGTTGTTCAGCAATTTACTTCCTTGATTAAAAGGGCAAGATTATAATC
TCAAGAGACTACAGAGGAGAGGTCGGTTCTAACATTACTGAGAAGTTCCAACGTAAGGTA
CTTGAGCTCGATGATCGCCTTGTCAAGCCAGTCTTCACAGAAAAAGATATAACTTACATG
TGGATCAGAGTTAATAATATATACATCGTTGCAGTAGCTAAGGGAAACCCTAATGTGGCA
TTAGTGTTTAGTTTCCTATATAAAATGTAGGAGGTTTTCACTGACTATTTTAAGGAGCTA
GAGGATGAGTCTCTCAGAGATAACTTCGTTATTACTTACGAGTTACTTGACGAGATGATG
GACCACGGTTATCCACAAATAACTGAAGTCAAGATTTTAAAGGAATACATTAAAACTGAA
GCCAATAAAATAGCAAAAGAGCAAACAAAGATATCACAAGCTAAACTCCCAACTGCAGCC
ACTAATGTTGTTAGTTGGAGATCAGAAAGCATCAAACATACTAAGAACGAAATTTTCCTT
GATGTCATTGAGAAATTGAACTTACTCGTCTCTGCAAATGGAAATGTCCTGCGATCTGAA
ATTTTAGGTACTGTGAGAATGAAGAGTTTCCTCAGTGGTATGCCAGAGTTAAAATTAGGT
TTGAATGATAAAGTGTTGTTTGAAATGACTGGTAGAACATCAAGAGGCAAATTGATTGAA
TTGGAGGATATAAAGTTCCATCAATGTGTAAGACTGAATAAATTTGAGACCGAGAGAAAT
ATTTCTTTTATCCCTCCTGATGGTGAATTCGAATTAATGACTTATAGACTAGATACTCAA
GTTAAACCCCTTATCTGGGTTGAATGCATTGTTGAAAACTTCTCAAGATCTAAGATAGAA
TATCTAGTGAAAGCAAAAACTTAATTCAAGTCTAAATCTATTGCAAATAACGTTGAGATT
TACGTCTCAGTCCCTTCAGACGTAGATTCACCAGTATTCAAGTCCAATGTAGGTACAGTT
AAGTACGTGCCAGATTAAAACTGCATGGTATGGTGCATCAAGCAATTCTAAGGGAGAAAG
GAATTTTTAATGAGAGCTTAATTTGGTTTCCCAAGTGTAGAAGCAGAGGAGAGAGAAAAA
TACTCTAGAGTTCCAATTCAAGTTAAATTTGAAATTCCTTATTTCACAGTAAGCGGTATA
CAAGTCAGATATCTTAAGATTGTGGAGAAGAGTGGATATCAGGCACTACCATGGGTTAGA
TATATCACACAAAACGGTGACTATCAGATTAGAATGACATGA


>Contig21523.0.g45(protein)
MSGLGCSAIYFLDQKGKIIISRDYRGEVGSNITEKFQRKVLELDDRLVKPVFTEKDITYM
WIRVNNIYIVAVAKGNPNVALVFSFLYKMQEVFTDYFKELEDESLRDNFVITYELLDEMM
DHGYPQITEVKILKEYIKTEANKIAKEQTKISQAKLPTAATNVVSWRSESIKHTKNEIFL
DVIEKLNLLVSANGNVLRSEILGTVRMKSFLSGMPELKLGLNDKVLFEMTGRTSRGKLIE
LEDIKFHQCVRLNKFETERNISFIPPDGEFELMTYRLDTQVKPLIWVECIVENFSRSKIE
YLVKAKTQFKSKSIANNVEIYVSVPSDVDSPVFKSNVGTVKYVPDQNCMVWCIKQFQGRK
EFLMRAQFGFPSVEAEEREKYSRVPIQVKFEIPYFTVSGIQVRYLKIVEKSGYQALPWVR
YITQNGDYQIRMT