Identifiers and Description

Gene Model Identifier

Contig21434.0.g6

Standard Name

None

Aliases

Contig21434_0_g6

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012628509.997093137033517e-262hypothetical protein
SGDYGL137W0.000008000552149328928SEC27 SGDID:S000003105, Chr VI
I from 249869-249886,2500...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21434.0.g6(coding)
ATGGACGATAGATCATACTAAAACTCAGATATGGGAGGACAGCAAATGCCCAACGGTTAA
TAGTAATACTACGAAGGTCAATAAGAGCAATATGGCTCTCCAGATGGCATGTATTAAAAC
GAGGAAGATATTTATGGGGATGAGTTAGACGGTGAGGAAGATAGAAATGATGGACTTAAC
GCTCTTAATTTGCAGTGGGTCATTGGAATCAATAAAGATATAGACTAGGGAGTGCATAAT
CTCACTACTGATTAAAGAACTGAAATATTTTATTCAGCTGCTCATACAGGTGTCTTATTC
GATTATAAATCAAAGACTCAGAGACTCCTTCAAGGTCACTGCAATAGAATAACTGCAACC
AGTTGTTCAGATGACAAGCGTTGGATCGTAACAGCAGACGGTGGAGACGATTCCATGCTT
GTGGTGTGGGACAGTGAGTCAGGTACACCCATAAGAACCTACTTGAACCCTCACCCTAAT
GGTGTCAAGACCATTGACATTTCTCTAGACAATAATTACTTGGTGACTCTTGGAAACGAT
GAGCCACAAACTATCTCATTGTGGGATTGGACAAATGAAAAAGAGGAGGGGCCAATTGTC
TCACTCTAATTCAAGTACACCGAGGAGTTTCAGAATTAACACTGGGTTAAATTCAATCCA
TCAGACCCCATGGAAATTGCTTCTAATGGCAAGGAAAGAGTTCTCTTTTTAAGTTGGGAA
CAGGGAGTTTCAACTTTCTAGTATTACTCACCACGTATCGAGAAGAAAGATTTCTCAACT
AAGGATAAATCAGAAGCTCATTTCACCAAGACTGTATTTATTCCAAATAAAGAAATGGCA
GTGACTGGTACAAATGCTGGTGACATTTTAGTATGGGACAGATCCCTAATCATAGAGGGA
ATCGGTGAATAAAATGAAAAAAGACTCATAAAAATTGTGACTTTTAACTAGAACAACTCC
CCAATCAACATCCTAATGACAGTTCATGATGAATACTTGGTTTGTGGTAACTCTGATGGA
ACTATCAGATTCTATGATTTCCATTTCAAGGTGGTAGCTTGGTTTGAAGATATGAACTTT
TCCACTATTAAGTCAATTTCCTTCTCTAAAACTGAACCAAAGCCATCAACTGACTTCCAG
GATGACATTGATAAGACATTCAAGTGCAGTGACTTCCTAGTGACTGATGACTCTGCTTTG
GTGTGCAAACTATGGTCAAGTATCTTTGAAGAGATTGATCCATAGAGAAAACGTGGAGAA
ATGATATTCTACGGCTTGAAATCAGCAGTGTCAGCTATTGCTGTACATCCAAGAAGACCA
ATATTAGCAATAGCTGGTTATGAGAAATTCGTGTTACTCTGGGACTATCAAAAGAAGGGT
GATCCCATTCTACACAATTACGAATTATTCAGGAAGGAAGAAACCAAGGAAAAGGATTCT
AAGCAGCACTATTTCACCTGCATGGTATTCACTCCAGATGGTGATGAATTACTCATTGGT
CAAACAAATGGTGTGATTTAAGTTATGGATCCAAATACTGGAATGTACAAAAAACTCTCT
CAACCACTAAAGACAACAGAAAGCTTAGTATCACCAATTACTCAGATGATTATGAGTAAT
GATGGATAATATTTTGCTACTATGGACAAAGCTTGCTGTGTTTGTCTCTTTAAAAAGGAT
CATCTTCAAGGTGACTCTTCAAAGCCAATAGAATGGCAATTCAATGGAAAGAAGAAGACC
CACGAAGTAGAGATAACCTCAATTGCCTTCGGAGAATCTCTTGATGAAAACGAGCAAACT
CGTCTAAGACTATTTTCAATCGGTAGAGACAGAAGACTCTTTGAGTATGATGTCTACGCT
AGTAACTTAAAAGAACTCATTGTAACAAGCATGTTTAAAATTGAGAAGGAAAGCCATCCC
ACTGCCTGTATTTGGTATCCTAAGGTTGATACTAAGGAGGACTTGCTTATGACTGTTAAT
GATGACTACAAGATGAAGATATGGAATGTAAGCACCAAGAATAGCAGAAGAACATGCTTA
GGACCTACTTATGGTGGAGAAATAGTCAAACTTAAGAAATTAGACATCGATAATAATCCA
GACAAGTTCTTGATCTACTCAACTAAGAAGAAGGTTATTGGATTGATTAAAATGCCACTA
GACGGCAATCCAAATAAGACAATGGGTCTCATTGCCCATCCAAGTGAAGTTGCCGATATA
TGTGCAACAAGTGATGGAAGATACATTTTCACTTGTGGAGGAGAAGACTTAGCAGTAAAC
ATGTGGAGCGTAGATGTCAATCCCATTGATCAAGCCATCATAATGGGTGGTGAGGGTATT
GAACCTTTCATCAATCTCATAGAAGGTGGTAGAGATGGTCAGACTTTCCAAGACATGAAG
GACTTCTTCTACTACGCAATGATCAGAGCAAAGGATGAAAACACAACTAAAACAAGAAAG
TTAAATGGAACAGTCCCCTTAGATGAACTGCCAAACCTTATGCGAGCCATGGGTTATTAT
CCAACAGAATAAGAAGTGACAAATATGAAAGATGAAGTTAAGTTCAGCAATTTTGCAGAG
ACAGGCTAGCATGTGAATGCTGTAGATCTTAATACTTTCATAAGATTGTTTGTCAACCAC
AGACCTGTTTATGGTATTGGCAAGAATAATATACAAGAAGCTTTTTAGGAACTATTTTCC
AACAACGTAGACAAGATGAATGGAACCATTTCTAAAGAGTACCTATTGAAAATGCTACAG
CAAGACGGTGAGCCAATGAGCGTTTAAGAACTAGAAGAAGCTTTGCATTTGCTAGTAGGT
GACAGCAACTTCAAGACAGCACTTACAAGTGAAGTTACAGCTGATTATTTCGCTGAGGAG
GTTCTTGGATTTGAAGAAGTTGAAGAGTTAGAAGAAGAAGATGGTGGTGCAGGTGGTTAT
GACGCACAGACAGCTATGATGATGGGAGGATCTTACTCATAGAATATGGGTATGGGTGGA
CTTGCTAATGATGTCATACCCGAGGAGGACTTATGA


>Contig21434.0.g6(protein)
MDDRSYQNSDMGGQQMPNGQQQYYEGQQEQYGSPDGMYQNEEDIYGDELDGEEDRNDGLN
ALNLQWVIGINKDIDQGVHNLTTDQRTEIFYSAAHTGVLFDYKSKTQRLLQGHCNRITAT
SCSDDKRWIVTADGGDDSMLVVWDSESGTPIRTYLNPHPNGVKTIDISLDNNYLVTLGND
EPQTISLWDWTNEKEEGPIVSLQFKYTEEFQNQHWVKFNPSDPMEIASNGKERVLFLSWE
QGVSTFQYYSPRIEKKDFSTKDKSEAHFTKTVFIPNKEMAVTGTNAGDILVWDRSLIIEG
IGEQNEKRLIKIVTFNQNNSPINILMTVHDEYLVCGNSDGTIRFYDFHFKVVAWFEDMNF
STIKSISFSKTEPKPSTDFQDDIDKTFKCSDFLVTDDSALVCKLWSSIFEEIDPQRKRGE
MIFYGLKSAVSAIAVHPRRPILAIAGYEKFVLLWDYQKKGDPILHNYELFRKEETKEKDS
KQHYFTCMVFTPDGDELLIGQTNGVIQVMDPNTGMYKKLSQPLKTTESLVSPITQMIMSN
DGQYFATMDKACCVCLFKKDHLQGDSSKPIEWQFNGKKKTHEVEITSIAFGESLDENEQT
RLRLFSIGRDRRLFEYDVYASNLKELIVTSMFKIEKESHPTACIWYPKVDTKEDLLMTVN
DDYKMKIWNVSTKNSRRTCLGPTYGGEIVKLKKLDIDNNPDKFLIYSTKKKVIGLIKMPL
DGNPNKTMGLIAHPSEVADICATSDGRYIFTCGGEDLAVNMWSVDVNPIDQAIIMGGEGI
EPFINLIEGGRDGQTFQDMKDFFYYAMIRAKDENTTKTRKLNGTVPLDELPNLMRAMGYY
PTEQEVTNMKDEVKFSNFAETGQHVNAVDLNTFIRLFVNHRPVYGIGKNNIQEAFQELFS
NNVDKMNGTISKEYLLKMLQQDGEPMSVQELEEALHLLVGDSNFKTALTSEVTADYFAEE
VLGFEEVEELEEEDGGAGGYDAQTAMMMGGSYSQNMGMGGLANDVIPEEDL