Identifiers and Description

Gene Model Identifier

Contig21276.0.g90

Standard Name

None

Aliases

Contig21276_0_g90

Description

SF-assemblin/beta giardin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • cellular modified amino acid biosynthetic process (IEA) | GO:0042398

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009414001.0002546821282671e-50hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21276.0.g90(coding)
ATGAATTATTAAAACGAAACATCTCTTGGGTACACGATGAAACAAGCAGTAGTCCAATCT
CTCGAAACAAGTCTTTATCATAACACTTCAATATCTCTAAATAAATCTGCAAGAGATGTC
TCTCCAAATAGAGTGAAGATATAATAGCTGTAGGAAAAGCTTCAATCGCAAATGCATGAT
GAAGATAAATCTACTGCCTCTAAGAGAGAGTTTTATGAATAAAAAATTAAGCAGATTGAT
GATAAAATGTCTAGAGCTCAACTTACCGAAGAAACTAAGTTTAAGTAAATGAAAGACTAA
ATCTCAAAGTTGATTGAAGGTATTCAGACTGAACAGATGTCAAGAGATTTATTAGATGAA
AGAAAATCCAAAGAATTGAAGTTGTGCGATAATAACATATAAATAGAGCTTAATGTTGAA
AGATAAAATCGCAGGGAAAGTGAAGCTAAAATTACAAAAATGATTGATGAGAGACTATAT
GGCTTGAAATTAGATTTAGCCAAGGAAAAGAAAATCAGAGAAGAAGCTGAAGATAGATAC
TACAGGACCTATGGTGAGCAGATAAATAGGCTTTAGGACGAGATAGATTTAGAGAACAAA
CTCAGAGAAGAAAACAGTTAATCTCTTGTCAACAAACTAAGCGATGAAATTGGGAAATTC
CACGAGATGCTATAATTAGAGAGAAAGTTAAGAGAAGAATCCTAAAACACTATGTTTAGA
ATGATTGAGGAGATTCACAATAAAGTCATGTATGAGTTGCAGAGAGAGGTCAGAGAGAGA
AAGGATACTGAAGAAAATTTACTTAAATTACTTGAAGAAACTTGTATTAGAGTAGAGAAA
ACAATTGTTAACTCTTGA


>Contig21276.0.g90(protein)
MNYQNETSLGYTMKQAVVQSLETSLYHNTSISLNKSARDVSPNRVKIQQLQEKLQSQMHD
EDKSTASKREFYEQKIKQIDDKMSRAQLTEETKFKQMKDQISKLIEGIQTEQMSRDLLDE
RKSKELKLCDNNIQIELNVERQNRRESEAKITKMIDERLYGLKLDLAKEKKIREEAEDRY
YRTYGEQINRLQDEIDLENKLREENSQSLVNKLSDEIGKFHEMLQLERKLREESQNTMFR
MIEEIHNKVMYELQREVRERKDTEENLLKLLEETCIRVEKTIVNS