Identifiers and Description

Gene Model Identifier

Contig21140.0.g103

Standard Name

None

Aliases

Contig21140_0_g103

Description

Adaptin N terminal region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004883509.997093137033517e-262Adaptin N terminal region fami
ly protein
SGDYDR238C1.9995317320402142e-140SEC26 SGDID:S000002646, Chr IV
from 940816-937895, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21140.0.g103(coding)
ATGTCAAAAGAGAGAGAAAAGTACTGCTACTTTATTATAAACTATGACGATATTGTGGAG
CCACCTCAATCCAGTGAGATACAAAACGCTTTTGTCAAGGGCACTCTGGATGAGAAAAAG
AAATCACTCAAGTTGCTTATTAAGATGATTTCGAATGATGATAATTACCCCCGCATGCTT
ATGCCAGTGCTTACAAACCTTCAATTGAACCAAGACCACGAACTCAAAAAGTTGCTTTTC
CTCTACTGGGAAGTTGTGGAGAAAACTAACCTCGATGGCAGTGTCAAGGATGAAATCACA
CTTGCTTGTAATGCACTTAGAAAAGACTTACTATCACCAAATGAGTTCATTCGTGGAAGA
ACTTTGAGATTGGTATCAAAGATCACAATTAAATCTATCTTGGAGAATCTAGTGCAAGCA
GTGATAGAGAATCTTACCCACCGACACTTCTACGTGCGCCGCAATGCTATAATGTGCATC
TACAGCATTTTCCAGAGCACCGGTACAGACCTGATCGAAGACTGCATAGACTCCATCGAT
ACTCTCCTCATTAATGAGACTGACCTTTCCACGAAGAGAAATGCATTCTTTTTGTTGTTT
CACTTAGCACAGGAGAAGGCGCTTGCCTACCTCAAGACCTTAATGAGCGCAAGCGATGAC
CCAGTTCAGGAAATGGGCGATATATTCTAGTTGATTGTCCTGGAGATGCTTAGAAAGCTT
TGTAAGATTGAACCTTCTCAGAAGCAAAGACTCATGAACGCAATCTTCATGCTATCTAAT
TCAAAGTCATCCAGTGTGCTATTCGAGTGCGCCAACACAATTACTCAATTGACTACCGCT
CCAACTGCCATTAAAATTGCAATTTAAAGTTATTTGAATCTCCTCTAAGATTAAAATGAC
AATAATGTCAAGCTTATAGTCCTCAACAAGATAATGGAGTTGAGATTGAAATACGCTAAA
CTGTTGGAAGACTACATTACAGACATCCTTAACACAATAAATGAAGAATCAATTTCATCT
CTTGAGATTAATGAGAAAGTATTGGAATTGACTACTGAACTTGCAAGCTCAAGAAACATA
AAGGAGATTATTGGATTCTTGGAGAAGGAAATTGTTAGAGCCAGAAAGATGGATGAAAGT
GGAGACTAAGCATCTACCACTAACGAGTACAGATACTTATTGATTAAGTCAATCAGCACA
TTGACTCAAAACTTCCCAGAGACAATCCCAAATGTACTCAGACCACTTATGGACTCCTTC
TTAATGTTTGATAATAGATCAACCTATACATCCCTTGAGACTATTCTTTTCATTCGTGAA
ATCATAGAAGTCCACCCTGAACATAGATAGGCAATATTCGATAAGATTTGCGATAACTTT
GAGGATATCAGATCACATCTAGTCATAAGAGTGGCGCTTTGGATAATCGGTGAGTATGCC
ACTTCATAGAGAGATGTGGAGCGTGCTTTCGACACCATCAAGAAAAATATTGGAGCTTTG
CCTTTGTTCAGTGAAGATTCACATGACCCAAACACTCCAGGACAAGAAGAATCCAAGACA
TCAACTTCAGGCCCAAAAGTGATAACAAAAACTATCATTCTCCCAGATGGTTCATACGGT
ACTGAGACCATAGTTTTGAACGATCCTGCTTAGGCTAAACTTTAACATACTTCAGCTTCT
GATGAGAATTTGCCCTTGAGAAAAGCCTTGATTAATACAGATGACGATTATTTGTGCAGT
TGCTTAGCTATCACACTTACTAAGCTCTCAATCAAAGCCAAGAAAAATCTCTCAGGGAAA
TTCAATTAAATGGCCATTGACTCCATTTTGATTATATGTGCCTTGCTCAAAGGATAGTAA
CTTAACAAGAAGAAACATTGTGACCCAGATTCCAAGCAAAGAATGTAACTCTGCCTAAGA
GTTCTATCAAACCCCAACGGTCTTAGTTCACTTTCAGCAATTGAAAATTTGCTCGTAGAC
CTAGGAAAGAGGGTATTCGCTAAGTTTTTGGAAACTCACAGTAAGTTAACAGGCATTGGT
GCAAAGAAAACTAAAAAGGGTGAGGAGAGCTTGTTGATCACTCAGCCAGATGAAATGGTG
GTGTTTAGATAGTTGAAGGGAAGAACCGGAGCCACTGATTTCGATATAACTGAGGAGCTC
AGTGGAGATGCTGGGAATGGCCTTGGCAATGAAGACTTTATGAAGGATGTGAGAAAAGAC
ATTGATGCTAAGATTTATCAGATGACTGGATACTCTGATGCTATTTATGCAGAGGCTTTT
GTAGAGGTTCATCACTATGATATTCTACTTAAGATATTACTTGTTAATAGAACCAATAAG
ACTGTACCAAACATCCAGGTAGAACTACTGACCCAAGGTAACTTAAAAATAGTGGAGAAA
CCTTAAGCCACTACCCTTAGAGCTCTCTCCTCCCAGACAGTAAAAGCTTCCCTGAAAGTG
TCATCTACAGACAACGGTGCCATCTATGGCTACATCACATTCGATTCTGCTTCTGGTAAC
ATCCCCAACATAATTAACATCAATGAGATTCAAATTGACTTTATAAATGAGCTGCAGCCT
GCTGAGTGCAGTGAACTGGACTTTAAAAAGAAATGGGCTGATTATGAGTGGGAGAACAAG
GTACATGTGAATACAGGCAGTGCAAATGGAGACTTGAGGGAATACGTTGAAAATTTCGCC
AAAATAATGAACGTAAAGCTCATGACTCCAATCAGTGAATAAGATCAACTCTCTGGCTTC
CTTGTTAGCAACCTCTATACCAAGAGTAAATTTGAGGAGGATTGCCTTATTAATCTGAGC
ATTGAGAAGTCTTCGTCTGGAGATGGCTCTTCTAGAATTACTGGACTCATTAGAGTCAGA
GCTAAGACTGAGGGTATGGCTCTTTGCATTGGAGAAAAGTGCAAAGCATTGAAGTGA


>Contig21140.0.g103(protein)
MSKEREKYCYFIINYDDIVEPPQSSEIQNAFVKGTLDEKKKSLKLLIKMISNDDNYPRML
MPVLTNLQLNQDHELKKLLFLYWEVVEKTNLDGSVKDEITLACNALRKDLLSPNEFIRGR
TLRLVSKITIKSILENLVQAVIENLTHRHFYVRRNAIMCIYSIFQSTGTDLIEDCIDSID
TLLINETDLSTKRNAFFLLFHLAQEKALAYLKTLMSASDDPVQEMGDIFQLIVLEMLRKL
CKIEPSQKQRLMNAIFMLSNSKSSSVLFECANTITQLTTAPTAIKIAIQSYLNLLQDQND
NNVKLIVLNKIMELRLKYAKLLEDYITDILNTINEESISSLEINEKVLELTTELASSRNI
KEIIGFLEKEIVRARKMDESGDQASTTNEYRYLLIKSISTLTQNFPETIPNVLRPLMDSF
LMFDNRSTYTSLETILFIREIIEVHPEHRQAIFDKICDNFEDIRSHLVIRVALWIIGEYA
TSQRDVERAFDTIKKNIGALPLFSEDSHDPNTPGQEESKTSTSGPKVITKTIILPDGSYG
TETIVLNDPAQAKLQHTSASDENLPLRKALINTDDDYLCSCLAITLTKLSIKAKKNLSGK
FNQMAIDSILIICALLKGQQLNKKKHCDPDSKQRMQLCLRVLSNPNGLSSLSAIENLLVD
LGKRVFAKFLETHSKLTGIGAKKTKKGEESLLITQPDEMVVFRQLKGRTGATDFDITEEL
SGDAGNGLGNEDFMKDVRKDIDAKIYQMTGYSDAIYAEAFVEVHHYDILLKILLVNRTNK
TVPNIQVELLTQGNLKIVEKPQATTLRALSSQTVKASLKVSSTDNGAIYGYITFDSASGN
IPNIININEIQIDFINELQPAECSELDFKKKWADYEWENKVHVNTGSANGDLREYVENFA
KIMNVKLMTPISEQDQLSGFLVSNLYTKSKFEEDCLINLSIEKSSSGDGSSRITGLIRVR
AKTEGMALCIGEKCKALK