Identifiers and Description

Gene Model Identifier

Contig21046.0.g14

Standard Name

None

Aliases

Contig21046_0_g14

Description

Proteasome subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511
  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

  • ( pfam00227 ) Proteasome subunit
  • ( pfam10584 ) Proteasome subunit A N-terminal signature
  • ( pfam01869 ) BadF/BadG/BcrA/BcrD ATPase family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR362C7.998673901528599e-62PRE10 SGDID:S000005889, Chr XV
from 1018746-1017880, Ge...
T. thermophilaTTHERM_004871101.9990871925214856e-61Proteasome A-type and B-type f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21046.0.g14(coding)
ATGAGTGGAACAGGATTTGATTACGAGTGCTCATCACTATCACCAGAGGGAAGAATCTTC
CAAGTTGAATACGCAGAGAAGGCAGTTGAAACTTCAAGTACAATTCTTGGAGTAAGATGC
AAGGATGGTATTGTTCTTGGAACTGAAAAGGTCATTCAAAGCAAAATGATGGTTGCAGGT
ACTGACAAGAGAATCTTCTCAATCACTGTCTAATCTGGAGGAGTTGTCAACGGTTTGATC
CCAGATGGAAAGTCTTTGATTCAAAGAGGTAGAGAGGAAGCAACTCAATACGAAAAGATG
TTCGGTATTAAGATTCCCAACAGTGTCTTGGCAGACAGATTAGCTATGAGAGCTCAAATG
AGCACTGTTTATTCAAGCTACAGACCTTTCGGAACCTCTCTTATATTTGCTTCACACGAT
CACTTAAAGGGAACTGCTCTTTACATGGTTGAGCCATCAGGATCTTGCTATGAGTACTAC
GGCTGTGCTTCAGGCAGAGGAAAACAACTCGCTAGAAATGAAATCGAGAAGACCAACTTC
CGTGAGATGACTATGGACCAAGCTATCCCTCAAATTGCCAAGATCCTTCTCAAGGCTCAA
GAAGAGATGAAGGAAAAGAAGCAAGAGATCGAAATAAGTATTCTTGGAGAGACCACTGGA
TATAAGCACAAGATTCTTGACCGCAAGTTCTTGGATGACCTTACCACCAGAGCACTCGAA
GATATTGAAAGTGAGCAAATGGAAATGGCATGA


>Contig21046.0.g14(protein)
MSGTGFDYECSSLSPEGRIFQVEYAEKAVETSSTILGVRCKDGIVLGTEKVIQSKMMVAG
TDKRIFSITVQSGGVVNGLIPDGKSLIQRGREEATQYEKMFGIKIPNSVLADRLAMRAQM
STVYSSYRPFGTSLIFASHDHLKGTALYMVEPSGSCYEYYGCASGRGKQLARNEIEKTNF
REMTMDQAIPQIAKILLKAQEEMKEKKQEIEISILGETTGYKHKILDRKFLDDLTTRALE
DIESEQMEMA