Identifiers and Description

Gene Model Identifier

Contig21039.0.g41

Standard Name

None

Aliases

Contig21039_0_g41

Description

Cyclin, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001965902.0001503375893664e-79Cyclin, N-terminal domain cont
aining protein
SGDYPR119W1.0000844672813518e-48CLB2 SGDID:S000006323, Chr XVI
from 771653-773128, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21039.0.g41(coding)
ATGTAATAACAGCAGCAGCAATTCACTCAATAGTAAAATTAACAGCAAAGCAGCAGTTAG
CGTTCTCGTTTCAATCCATACTTCTAAACCACTCAAGGAGCCCCCTCTCTTATTCCCAAT
ACTGAAAATATGGGTGGTGTAGCCTCACAGGGTCTGGAGCAAATTCAAAGAAATAACAAA
GAGAGATCTAACACAAACAGATTCTATGAAAACTCCTTCATTAATAAAACTTATAACAAT
GTAAGATCATTTGGTAAAGATCTCTCAAACATGCAACAATACCAAGAGGCAAAGAACGTG
TATGGAGATGGTCAAGAGAACAAGAGCATGAACGGTCTAGCACATCAATAACCCAAAATA
CTCAGAGTCAAGTCGCAAATTGGATCAGCGGCACCTCAGACAAATGCGACAGCTACATCT
ATTAATAATGGTAATTAAAACAATCACTAACATAGATTCCTAAACAACAAAAATAACGAA
AGTTTGATTAATACTTCAAGCAACGCTTAGCACAGCATTGAGTTCAACCCACATCAGTAA
TTGCCAAGCAAATTCCTCATCACCAAGAGCACAGAAGGAAATCTTCATCATCAACAACCT
CAAGCTCAACATCGCCGTGTTGGTAACAGTTAGGAAGGTCGCAATATGAATATTTCCACT
AGGAGCGCTAGAGAGATTAATCATCACGGTCATTTGAAAAATATGGCAGGCACCCACACT
CAACAGCAAAATCATCAATACTTAGGAGGATCAGGCATATCAAGTCAGAGTTAAAATCCA
CAAGGGCTTATCCAATCAAACTCATCCCTTATCATGAATATACCTTAGCAGAATAATTTC
AACATAACCGCTGCTAGTAGTAATACTACTGCAGCCAGCATTAACTTCACTAATGCCCAT
CAACTTTCAATTCTAAATCCATTATCTTTGGCAAGTGAAAAACACACTTCAGAAGACATG
TATCACATGCAGTTTAACAACATAATGCAAAGAACTCTCCCCACTTAGATTCATTAGCAA
GAAGATCTTTTGATGAAGGAAGATGAAGAGGCTATGCTTATATCCTAATCCTAGAGTACA
CATCAAGAAAAAACTAAAGATAAGCTATTAAATCTAGAGAAATTCTGGCAATAAACTGTT
AAATAGTACCTAGACGAAAATGTATGCGATATAGATTTTCAAGATGTGCATAATCCCCAA
GCCGTTGCTGAGTTTGCAGAGGAATGCTCGCAACACATGCTTCGCACTGAAAAGGACTAC
ATCCCAAAGGTCGGTTACATGACTCAACAGAACGACATCAACGAAAAAATGAGAGCTATT
CTTGTTGATTGGTTGATTGAAGTTCATCACAAATTCAAGTTACTTCCTGAGACACTATTT
CTAACTGTCAACTTGATCGATAGATACCTTGAAAGATAAGTTATTCACAGAACAAAGTTG
TAACTTGTAGGAGTTACAGCCATGCTTATCGCTTCAAAGTATGAGGAAATCTATGCTCCA
GAAGTTAGAGATTTCGTGTACATTACAGACAAGGCATACTAAAAAGAAGAAATCCTGAAG
CAAGAATTTGCTTTATTGACTGAGTTAGAATTTAATATTTGCACACCATCTAGCTATCGT
TTCTTGGAAAGATTTTCCAAAGTTGCTAGCATCGACACTAAGCAATTTAACATGGCAAGA
TATCTTATTGAACTTCCTCTTATAGAATACAGAATGCTTAAATACAACCCATCTCTATTG
GCAGCCAGTGCCTTGTTCCTCGCTTTGAAAATCATACCCAAGTTTGATGAAAACGATTCC
TCCATTAAACTGCCAGCTTGGGACGAAAAGATGCTGAAACACACTGGTTACACCGAGAGT
CAATTGAGACCCTGTGCTAAAGATCTATGCATCTTGCTTCAAGGCATTGAGAAGTGCTCA
CTCCAAGCTGTAAGAAAGAAGTTTTCAAACTCTGCTTACAACGAGGTTGCATTAATCCGC
CTTGAAAACTGA


>Contig21039.0.g41(protein)
MQQQQQQFTQQQNQQQSSSQRSRFNPYFQTTQGAPSLIPNTENMGGVASQGLEQIQRNNK
ERSNTNRFYENSFINKTYNNVRSFGKDLSNMQQYQEAKNVYGDGQENKSMNGLAHQQPKI
LRVKSQIGSAAPQTNATATSINNGNQNNHQHRFLNNKNNESLINTSSNAQHSIEFNPHQQ
LPSKFLITKSTEGNLHHQQPQAQHRRVGNSQEGRNMNISTRSAREINHHGHLKNMAGTHT
QQQNHQYLGGSGISSQSQNPQGLIQSNSSLIMNIPQQNNFNITAASSNTTAASINFTNAH
QLSILNPLSLASEKHTSEDMYHMQFNNIMQRTLPTQIHQQEDLLMKEDEEAMLISQSQST
HQEKTKDKLLNLEKFWQQTVKQYLDENVCDIDFQDVHNPQAVAEFAEECSQHMLRTEKDY
IPKVGYMTQQNDINEKMRAILVDWLIEVHHKFKLLPETLFLTVNLIDRYLERQVIHRTKL
QLVGVTAMLIASKYEEIYAPEVRDFVYITDKAYQKEEILKQEFALLTELEFNICTPSSYR
FLERFSKVASIDTKQFNMARYLIELPLIEYRMLKYNPSLLAASALFLALKIIPKFDENDS
SIKLPAWDEKMLKHTGYTESQLRPCAKDLCILLQGIEKCSLQAVRKKFSNSAYNEVALIR
LEN