Identifiers and Description

Gene Model Identifier

Contig21024.0.g66

Standard Name

None

Aliases

Contig21024_0_g66

Description

Tubulin/FtsZ family, GTPase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005586209.997093137033517e-262Tubulin/FtsZ family, GTPase do
main containing...
SGDYML085C9.997093137033517e-262TUB1 SGDID:S000004550, Chr XII
I from 99259-97941,99400-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21024.0.g66(coding)
ATGAGAGAAGTTATTTCAATTCACGTTGGTCAAGCCGGTATCCAAGTCGGTAACGCTTGC
TGGGAGCTCTTCTGCCTCGAGCACGGTATCTAACCTGACGGTCAAATGCCATCAGACAAG
ACCATCGGTGGTGGTGATGATGCTTTCAACACCTTCTTCTCCGAGACTGGTGCTGGTAAA
CACGTCCCAAGATGCGTTTTCCTCGATCTCGAGCCAACCGTTATTGACGAAGTCAGAACT
GGTACCTACAGACAACTCTTCCATCCAGAGCAACTCATCTCAGGAAAGGAGGATGCCGCC
AACAACTTCGCCAGAGGTCATTACACCATTGGTAAAGAAATCGTCGATCTCTGCCTCGAT
AGAATCAGAAAGCTCGCTGATCAATGCACTGGTCTCCAAGGTTTCCTCGTCTTCAACTCA
GTTGGTGGTGGTACCGGTTCAGGTCTCGGTTCACTCCTCCTCGAGAGACTCTCCGTTGAT
TACGGTAAGAAGTCAAAGCTCGGTTTCACCGTTTACCCATCACCATAAGTCTCAACTGCC
GTCGTTGAACCATACAACTCAGTTCTTTCAACTCACTCCCTCCTCGAACACACTGATGTT
GCCGTTATGCTCGACAACGAAGCCGTTTACGATATCTGCAGAAGAAACCTCGATATTGAG
AGACCAACCTACACCAACTTGAACAGACTCATTGCTCAAGTCATCTCATCCTTGACTGCC
TCCCTCAGATTCGATGGTGCCTTGAACGTTGATGTAACTGAATTCCAAACCAACTTGGTC
CCATATCCAAGAATCCATTTCATGTTGTCATCATATGCCCCAGTCATCTCAGCCGAGAAA
GCTTACCACGAGCAACTCTCCGTCGCTGAAATCACCAACTCAGCCTTCGAGCCAGCATCC
ATGATGGCCAAGTGCGACCCAAGACACGGTAAATATATGGCTTGCTGCCTTATGTACAGA
GGTGATGTCGTCCCCAAGGATGTCAACGCTGCCGTCGCCACCATCAAGACCAAGAGAACC
ATTCAATTCGTCGACTGGTGCCCAACTGGATTCAAGTGCGGTATTAACTATCAACCACCC
ACCGTTGTTCCAGGTGGTGATCTCGCCAAGGTTATGAGAGCCGTCTGCATGATCTCCAAC
TCAACTGCTATTGCTGAGGTCTTCTCAAGAATCGATCACAAGTTCGATCTCATGTACGCC
AAGAGAGCCTTCGTCCATTGGTACGTCGGTGAAGGTATGGAGGAAGGTGAATTCTCCGAG
GCCAGAGAAGATCTTGCCGCCCTCGAGAAGGACTACGAAGAAGTCGGAATCGAGACCGCC
GAAGGTGAGGGTGAGGAAGAAGGTATGGAATGA


>Contig21024.0.g66(protein)
MREVISIHVGQAGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK
HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
RIRKLADQCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA
VVEPYNSVLSTHSLLEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTA
SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP
TVVPGGDLAKVMRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGIETAEGEGEEEGME