Identifiers and Description

Gene Model Identifier

Contig20952.0.g94

Standard Name

None

Aliases

Contig20952_0_g94

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005007909.997093137033517e-262Leucine Rich Repeat family pro
tein
SGDYKL193C0.000000000010004361180063202SDS22 SGDID:S000001676, Chr XI
from 79882-78866, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20952.0.g94(coding)
ATGGTAGATAAAAAGAAGAGCAATAGCAACGATCCCGAGTGCAGACTAGACTACGTTTGT
GAAGCATTGGGTATAAACAAGGGAGCATTGCACTAAGTTACAGATATAGATTTTGTGTTG
GATGACATTTGTCGCATGGACTTCCTCTCTTATTTCACTAACATAAAAACACTCACACTC
ATTAATCAAGGAATTTCAGAAATCGAGGGATTGGATAAAATGGTCAATTTGGAGCAGATG
TGGCTTAGTGAGAATTTAATTGAGAATATAAAAGGACTTGATAAATGCAAAAACCTAAGA
GATTTATTTTTGACAGCCAATAGAATAAAGCGAGTGCGAGGATTGGATAACTTAATAAAT
CTTGAGAAATTGTGGCTTGATGAAAATCGCATTGAAAATTTGGAGAGTGGAATGAGTTGC
CTCGTTAAGCTTAAAGAGTTAAATGTTGCAGGAAATAAAATTGAGTGCATCGGGATGACT
CTCGATGGTTTAATTTCGCTTGAAGAATTAAACATTTCTCAGAACAAAATCGGTAATTTC
AAGGAAGTGTTGAACCTAAATCGTCTCCCAAACCTTAAAACCTGCACTTTCCAGGACCCT
CACTACGGGGATAACCCAATCTGCAATTTATGCAACTACCAGACATTCGTGCTCTATCAC
CAGCCTAATTTGCAGAAATTGGACACTCTGTAGATTTCAGATGATGCGAAGGCGTTTGCG
GATGCCACTTTTATGAAGAAAAGGATGTATTATAACATGAGAATCAAGACTATTCAAAGA
AATGCTAGTAATATCATGAAACTGCTAAAAATTTGCAAGAAAATTCGAACTTTCAAAATC
GACATCCAAGTGACTAAACTTACAAAGAAAATGCACGAAGTCACCAGAGAACTAGAGGAA
AGACAATATATAGGGGCTCAGGGTGTCTAAAACAGAGAGTAATATGAGGGTGTGTTCACT
TATGGAGCCACTAATGCCAAGAAGAACCCACTTGATGACATTGATAATGAGAAACTCATT
AATGATCTGGAGGGGAAGAAAGCGCTTATGTAGGGTAGAGTTCATGATAAAAACGAGGAT
TTAAAGGATTTAGATGCTATCTATGATTCATTAAGAAAGAAAATGTATGAAATACCTGAG
TAGAATATCCACCGACTATTAACTGAACTGGAGACTGGTGGGAACATAAGATTCGAGGAG
GGCAAACCCAGTGACAAATGGTTCCAGAGTTGCAACGAGCTGGCCAAGGGCAGATTCAAC
CCAGAGCAGATGAAATTCTTCGGCATCACAGGCATTAATGTCACCAGAGTCACCAGGATT
CACAACAGGTTCCTTAGGAACAGATTTGAGGAGAAATTGGAGTAACTGGTTGATTTGTCT
GATATTTCTTATAAACGCAGTCTGGAATATCTTTTCTATGGCTTAGATCCACATTTACCT
AATGAAATGTAAAGAGCTATGGAGGAGGGATTTAGAACACCCCAAGAATATCAATAAGAA
TGCGGTTTGCCACTATCTGTATCACTTGTTAACTCCGTGGCTTCAGCTGAAATAGCCAGA
ATAAACTCTTTTTTCCAGGCTGAAGATGGCTATGCACATATTAGAACAGCTGCTAAAGCT
TAAAAATAGACTCAATTCAGGATGAGCAGTGAATTGACACTTCAAAAAGGGCTGGTTTCA
ATTCCATCAGGCTAGGTCTTGGTTTGCAAAGTGTTTTTGAGTAAATGTGTGCCGGACAGC
AACTTCCCATATTTTAACCCCAGTCATTCTCCCTCAGAGATCTGGAGGTATGCACCAGTA
GACACTAAGTAGTACGCTGGGATGCAGAGTATATACAGAACTAAGGAAAATGACTAGAGA
TAGAGAATGTGGTTTGTGCTTGACAACGCGCTTATCTTGCCTGAATATCTGGTTGAATTT
GAATACACTACTAACCTCAATAAGAGCAATCCAGCAGAAAATGTTAAATCTATGGATACA
GTTGAGTAACTGAACGAAGACTGCAATAAATTGCTAAACGCTGTAAACGGTGCCTAGAAA
GTGCTAGAAAACACCTACATCAGACACGCCCAAAGAGAAGCAATTCGCTCCCTAAATCTC
CACTTGACCGCCCTAGACCTAGACAGATCTGACATGGGTTGCTTAAAAAAGACACTTGTG
AATTTCATGAGGTCATGCCACATTGAAGAACTTCTCACGAATGGTTTTTAATTCTTGGAT
GATGATTCTTAAAATAATGCATAATTGGCCATTGAAAACTCCATGCCACCTGAGATACCA
GTGCGCAGCAAAATAGATGAGATTAGTGAATATATACTTACTAATATCAGTAGAGAGAAG
GATTTCAGTCAAATTGTATACTTGAATTTGTTTAGCAATAGAGTCAAGAAAATCAAATGC
CTGGAGAAATTAGTAAACCTAAACACTTTAATCCTATCATTCAATGAAATAGAAATGATT
GAGGGACTCTAAGAGTGTAAAGTGCTTAAAAGATTAGATTTAAATCACAATTTCATTCGT
AAAATAGAGGGACTAGATAATAAAGTTAATCTGTAAACACTTAATCTCACCAACAACTGG
ATATCAGACATAAACATGATTGAACACTTGAGAATACATTGTTAATCTATTAGAGAATTG
TCACTAAGATGTAATCCTATATCTGCTAAGAAATCTTATAGAGCTATTGTTTTCACTAAA
TTAGGAGCTGGATTGGTAAAACTTGATGGTATAGCCCAAACTGATAAGGACAAAGAGAGA
GTGAGGACCCAGGATTAAGTATCAATAAGCAAGGAATTAATCTATGAAAACGTAAGAGCT
CAGATAAAAAAGAGTGAAGGTGGATAGATCACAACCATATCCACCACTCCATAAGATCAG
AGTAAAAAGTCCATAGTAAGTCAGAAATCGAATGTTACAGTCAATGATACAACAGACTTA
GATTCATAGTTAACTTTCAGTAGTAATAATCAAACTGATTGGGAGAGAAACATTGAAACT
TTGATTTTGAATCATAAAAATTTAACGAAAATAGAAGCATTAGACGCATTCTTAAACCTT
AGAAAGCTTTAACTGATTGATAACTGTCTCACTAAAATTGAGGGTTTATCGAAATGCAAA
TTATTGGAAGAATTGTCTCTTGAGAAGAATAAACTTTAATAAATTGAGGGAGTTGGATAA
CTCAGATATCTTAAGAAATTAGACTTAGGATGCAATAGAATAAAAAGAATCGAAGGTCTA
GCCTAACTAGAAAACTTAACACAGCTCTCAATGGAAGACAACGAGATCTCAAACCTAGAC
GGCCTTGAAAACCTCCAAACCCTCATGGAACTTTACCTGGGCAACAATTTGATCAGTGAC
ATCAAGGAAATAGTTAAACTTAAGCAGCTGGGTAGACTGATTATTTTGGATATTAGTGGG
AATAACCTATCTAGAGACTCAAACTACAGGATTTATTGCATTTTTCATTTGAGGAAGCTG
AAGGTTCTGGATGGAGTCAGTGTGGAGTCGACGGAGCATATGGATGCCAAGGAGACCTTT
GCTGGTAGACTCACTGAAGAAATTCTTGAGAGTAGAATTGGATTAGGAAAGAAACTGAAT
GACATTAAGGAGTTAGATTTATCATCATGTAGATTAAGAGACTTTGATAATATGTTTGAC
GAAAGTTTATATCCATAATTGAGAGATTTAAATCTTTCTCATAACAGCTTGGTAACACTC
AGAGGATTTGGATATTTGCCTAAATTGAGAATACTAAAGATCAAAGCTAATAGATTAGAG
ACACTTTTTTGCAAGCCAAACGAAGACGGCTATCCAAAGGGACTATTCGGATTGCCTGGC
CTAGAAGTTTTGGATGTATCCTATAACAACTTGCACGACCTCTACGGTTTACAGTACTCC
CCCTTAAAAGACTTGAAAATTTTGAATGTATCGAATAATGACATAGTAAAAGTTGATTTT
TTGGAGAAACTCAAGGCACTTAGAGAACTAGATCTCAGTAAAAACAGGATTAGATAAATT
GATCAGAATTCATTCTAAAATTTCCATTTGATTACATGTCTGAGACTGGAGGATAATGGC
TTGAGGAACCTGTAAAATGTTGAGAAATTGGAGAGATTGCAATCGCTGTTCGCATCTGGC
AATCGCTTGGCTGAGTTTTGGGAAGTTGATAGACTATCAGAGTTGCCTCATCTAATGGAA
ATTGCATTGCTAAATAATCCAATGACAAGAAAACCTAATTATAGAACTGCTATTATCAAA
CGACTTCCTGCTTTAATTATTCTTGATGGCAAGGAAATATCTCCTGAGGAACGTTAACGT
ATCGAATAAGCTGGAGGATTGATAGGGCCAAGTGGAATGACAGCAGACGGTTAGAAGCCT
CAACCCATGATTCATTTCGCCTAATACCCCACTGTGAAGGTTCCAGTTAAATTAAACGCA
GTAAACTTCGACGGAGTCTTCAGCAACATGAAGGTATTTCAGTAGGATGCCAGTGGCTCA
GTGTAGCAGCAATTAACCTCTTAACAGTAGCAGCAATTGATGATGAATTAGAAAAATTAG
ATGATCATTGGGGGTGGACCAGGTGGGATTGTGGGTCAGGGCTTAGGAGGTATAAGCGGT
ATAGGTATAGGGGGAGGTAACAACGGTGGCTTAATGATGGGAGGCAACGACCTGGGCAAC
ATGATATAAGTTAACAGTATAGGAGGGGATTTCAATGGTGGTCAGCCTATTAGTGGACTG
GGCATGCAAGGGAAACATGATTCAAATAATACAAGAAGACCAAGTACTAAGACAAACCAG
GGTGGTGGGGCTGTAATAGGCTCCTCACAATCCTCTATTCAATAAAAAGACAAGTAGATG
ATCGGCAAAACTGGTTGTAAGAAGTCATGA


>Contig20952.0.g94(protein)
MVDKKKSNSNDPECRLDYVCEALGINKGALHQVTDIDFVLDDICRMDFLSYFTNIKTLTL
INQGISEIEGLDKMVNLEQMWLSENLIENIKGLDKCKNLRDLFLTANRIKRVRGLDNLIN
LEKLWLDENRIENLESGMSCLVKLKELNVAGNKIECIGMTLDGLISLEELNISQNKIGNF
KEVLNLNRLPNLKTCTFQDPHYGDNPICNLCNYQTFVLYHQPNLQKLDTLQISDDAKAFA
DATFMKKRMYYNMRIKTIQRNASNIMKLLKICKKIRTFKIDIQVTKLTKKMHEVTRELEE
RQYIGAQGVQNREQYEGVFTYGATNAKKNPLDDIDNEKLINDLEGKKALMQGRVHDKNED
LKDLDAIYDSLRKKMYEIPEQNIHRLLTELETGGNIRFEEGKPSDKWFQSCNELAKGRFN
PEQMKFFGITGINVTRVTRIHNRFLRNRFEEKLEQLVDLSDISYKRSLEYLFYGLDPHLP
NEMQRAMEEGFRTPQEYQQECGLPLSVSLVNSVASAEIARINSFFQAEDGYAHIRTAAKA
QKQTQFRMSSELTLQKGLVSIPSGQVLVCKVFLSKCVPDSNFPYFNPSHSPSEIWRYAPV
DTKQYAGMQSIYRTKENDQRQRMWFVLDNALILPEYLVEFEYTTNLNKSNPAENVKSMDT
VEQLNEDCNKLLNAVNGAQKVLENTYIRHAQREAIRSLNLHLTALDLDRSDMGCLKKTLV
NFMRSCHIEELLTNGFQFLDDDSQNNAQLAIENSMPPEIPVRSKIDEISEYILTNISREK
DFSQIVYLNLFSNRVKKIKCLEKLVNLNTLILSFNEIEMIEGLQECKVLKRLDLNHNFIR
KIEGLDNKVNLQTLNLTNNWISDINMIEHLRIHCQSIRELSLRCNPISAKKSYRAIVFTK
LGAGLVKLDGIAQTDKDKERVRTQDQVSISKELIYENVRAQIKKSEGGQITTISTTPQDQ
SKKSIVSQKSNVTVNDTTDLDSQLTFSSNNQTDWERNIETLILNHKNLTKIEALDAFLNL
RKLQLIDNCLTKIEGLSKCKLLEELSLEKNKLQQIEGVGQLRYLKKLDLGCNRIKRIEGL
AQLENLTQLSMEDNEISNLDGLENLQTLMELYLGNNLISDIKEIVKLKQLGRLIILDISG
NNLSRDSNYRIYCIFHLRKLKVLDGVSVESTEHMDAKETFAGRLTEEILESRIGLGKKLN
DIKELDLSSCRLRDFDNMFDESLYPQLRDLNLSHNSLVTLRGFGYLPKLRILKIKANRLE
TLFCKPNEDGYPKGLFGLPGLEVLDVSYNNLHDLYGLQYSPLKDLKILNVSNNDIVKVDF
LEKLKALRELDLSKNRIRQIDQNSFQNFHLITCLRLEDNGLRNLQNVEKLERLQSLFASG
NRLAEFWEVDRLSELPHLMEIALLNNPMTRKPNYRTAIIKRLPALIILDGKEISPEERQR
IEQAGGLIGPSGMTADGQKPQPMIHFAQYPTVKVPVKLNAVNFDGVFSNMKVFQQDASGS
VQQQLTSQQQQQLMMNQKNQMIIGGGPGGIVGQGLGGISGIGIGGGNNGGLMMGGNDLGN
MIQVNSIGGDFNGGQPISGLGMQGKHDSNNTRRPSTKTNQGGGAVIGSSQSSIQQKDKQM
IGKTGCKKS