Identifiers and Description

Gene Model Identifier

Contig20945.0.g40

Standard Name

None

Aliases

Contig20945_0_g40

Description

Domain of unknown function DUF221

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

  • ( pfam02714 ) Domain of unknown function DUF221
  • ( pfam07282 ) Putative transposase DNA-binding domain
  • ( pfam04547 ) Calcium-activated chloride channel

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004923801.0000844672813518e-48hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20945.0.g40(coding)
ATGTAGATGGATTAAACTCAACCACCGAAAAATAATAGTCCTAATGCTAAAGCCTAGCAG
TAACATCAAATGAGGAGTAATAAACAGGATGTTTCGATTGCATCTTAATCATAAAATACC
TCACAAATCGCTCAAACAGCTTACCAGCGGACTAAGACAGCGATAAAGAATGCAGAAAGA
ATGGAAATCAATAAATTTCTTGCAGAGGAAAACGAAGATACGGAATTCAAAATGACTTCA
AACAATACAGATCCTGACAATGCAGCCTAGAATATACAAAATATGAGGAAGGTCAAAGAT
CCTATTTAATAATTCTTAAGACAAGTTCCTCCAGACTTTAACAAAGCTGAAATTCATGGC
GCTGGATCGCATTTTCCATTGTGTACTGATATCAAAGAGCTTTATCCCTTAGGTCCTGGT
TATCCAATGTATTACGCTTTGAAAAAGAATCTAACATGGCTACTTTTCATTTTAGCTATA
ATTTGTGGTATCCCTTGCACTATTCTCTCTGGCATACAGACCTTAAAGAAATCTGGTTAC
GATATATCTTCCTATCCTTACATGTCTAAAATCTCTATTGGAAATGTGTTTGAATTGAAG
TAAATGTTCTCAGATGACGCTCTAATTGTGTTTGCAGACGTGATTGTTTACTTAAATGCA
GCTGGAATAGTTTACCTGCTCATCCACTCAATATGGCTGAGGAAAATGCTAATTCAGACA
AATAATGACCTTGACTAGGATGTAGTGTCACCGTCTGACTTCACTATTGTTGCTAAGCAC
TTGCCCAAAAATTTAACACCTGATTAATTCAAAGAGAAATTTGAAAAGCAATTTAGTAAG
TATGGTATTAAGGTAGCTTATGTTAACTACGCATACAACATTGAAAAGATGTATGCTTGC
AACAAGGAGCTTATGACTTTATCAAGATAAAAAGCTATGTTTAAATTACACCTGAGAAAA
TTCATGCAAGACAGAGGTTTAACAAGGGATAAGATACAACAAGATAGATCTATTGAAGTC
CCTCCTCTCAGAATTTAAACTGGTATATGCAAGAGTTACACCATTACTCTTGAGCAAATT
AATAAAAGCATTGAGAAAGCCCAAAAAGAGATGATTGATTTCGAGTAGAATTTAGCTCCA
GGCTCTAAAGAGGATCTTTATATTGGTACTGCATTTATAGTGCTTCAGACCTAGAGAGAT
TAATAGACCTTAATTAACTTATATGATGACTCAATTTGGACAAGATTAACGCAATGGATA
AGCAACAAATTTTGCAGTTGTTGTGGAGACCAAGAAAAAGTTACAGCTGAAAATAGATTC
CAGAGAGCTCCAGAGCCTACTGATGTTTACTGGGATAACCTCAATATTGGCTTCTTTGAA
AGAGTCAGAAAAATCTTAAAGACATACTTTGCTACCATTCTCTTAGTGGGAGCTTGTTTT
GGTATTATATATGGTATTAATGTTGGCAAAGATAAACTTAATAATAGTTCAGATTCCATA
TCAGATAGGACCATTAGATTTTTATCTATATTGTGCTCCTTCATTATTGTGTTCACAAAC
ATTTGTTTAAGAACAGTTATTAGAGCATTTACCTAAACGGAGAAGCATGAAACTTATACT
GCTTATAACTTATCAGTTGCTTTTAAGCTTACATTTGCAAGATTTATCAACACATCCATT
GTTCCAATAGTCGTTAATGTAGCTACCAGTAGATGGTTCGTTGATGGTGGTCTAGTCTCA
GATATCTTCTATATTATGATTTCCATATCATTCCTCGACCCTATACTCTATGCACTGGAT
CCATTTTATGCTATAAGACTGTTTAAGAGATTTAGAGCCAGAAGACAAGGAAAAGATAGC
ATCATGAACCAAGAAGAGGCAAACCTTTTGTGGGAGGGACCACCTTTGGATATGGCAAAT
AGATATTCAAACACAGCTAACTTATTCTTGACTGCAATATTCTTCCATCCCCTACTTCCA
ATTTCAATCCCTATTGCTATGGTGGGCTTTATATTCTCATATTGGATTGATAAGTCATTG
CTATTGAGAAGACATAAAATACCTGAGCAAATGTCTGGACTCATGGCAAAGTTCATTGCA
AATCTATTGCCTTATTTTGCTTTCTTATGGTCTCTCAATTTATTGCTTTTCTACAGAACT
TTATATAAGGAGTACTACGAAGATGATCCAAGACAAAAGCTAATTGTCCCTTATGCTATC
ATCGGTCTAACAAGTTTTTTCATTATCCTGCCAGTAAGAACAATTATCAACAGATGTTTA
GCTGATAACACAGAGGATGCCTTAACCTATAAATATGACGATTTTATGCTTTAATTCCCA
ACAGACTACGACAGAGAAAATCCAGTCACCAAGAACGAGGCTTTCATTAAGTTACTCGAG
CATAGAATTTAAAAAGAGAAGAACTCTGTAGAGTAGGACAAACTTCTCCTTCAAAAGAAT
CAGTTAACTAATGCCTCAGTATTTGACGCAGTGAGAGCTTATTCAAACAAGAGAGAAGCC
ATGAAGCAATAAATGCAACAGCATTCACTTCCAGGATTCTCCTAAGGACAACCTTAAGCC
TAACAAGGCAACCTTGGCCAGGCTATGATGAGAGCTTACAATTTTAACACAGCTTAAGTT
TAGATAAATTAGGATCCAACCCAAGCTTTAAGATAGGGTGTTTCTTAATACTATTAGCAA
TACAGCTAAGGATAAGTATACAATGGAGCATATGGAGGAGGAGCTTATGACTATTACAGT
CAACCACAACAATATGATCCTTACGGTTATTATAACAATTACAATGCTAGTAATGCTTAT
GGTTAAAACTATAATCCTGCCATAGCCGCACCTGCTTCAGTGTATGATAATGTTTACGAT
CCTTACGCAAGAGCAGCCGGAGCTACTGCTTCATCAAATTACAACAACTAATACCCAGCA
TCTTAGTCTAGTCATCCAAGAACTACAGTTAAGGTCAAAGAAGACTTGCACAAGGAGAAA
AATCCTAAGAACTTGAAAAAGAAGAAAGATAACAGCAGCGACAGTGATAAGAAAAAGAAG
CATCATGGCAAAAAGCATCAGTAAAATGTGAAAGTAAATGACTCTTAACTCGCCATAAAC
CAAAGCGCAGTTCGCACTTCTTAAGAGTAGCAAAATAATAGTTACACTGCTTAAAACACA
AACAATCAGTATCCTAACTTAAACGGCAATCCAGTTGCTTATGATTAATACTCTCAAGCC
ACAGGTGGTGTTGGAGGGTATGGCAATAATAACTACTCACAGCAAGCAACATATGACTAT
AACTAGAATGTACCTGCAGCTCAGCAGTAATAGTACAATGATGCAGCCTATTAGTAATAG
CAGTAGTACACAGCTGCTCAATAATAGCAATATACAGCTGCTCAGCAACAATAATACGCA
GCCCAAGGATATGGCCAGTAGTATAATGCCTAATATCAATAGTAATAATATCCAAATCAA
GGATATTATTGA


>Contig20945.0.g40(protein)
MQMDQTQPPKNNSPNAKAQQQHQMRSNKQDVSIASQSQNTSQIAQTAYQRTKTAIKNAER
MEINKFLAEENEDTEFKMTSNNTDPDNAAQNIQNMRKVKDPIQQFLRQVPPDFNKAEIHG
AGSHFPLCTDIKELYPLGPGYPMYYALKKNLTWLLFILAIICGIPCTILSGIQTLKKSGY
DISSYPYMSKISIGNVFELKQMFSDDALIVFADVIVYLNAAGIVYLLIHSIWLRKMLIQT
NNDLDQDVVSPSDFTIVAKHLPKNLTPDQFKEKFEKQFSKYGIKVAYVNYAYNIEKMYAC
NKELMTLSRQKAMFKLHLRKFMQDRGLTRDKIQQDRSIEVPPLRIQTGICKSYTITLEQI
NKSIEKAQKEMIDFEQNLAPGSKEDLYIGTAFIVLQTQRDQQTLINLYDDSIWTRLTQWI
SNKFCSCCGDQEKVTAENRFQRAPEPTDVYWDNLNIGFFERVRKILKTYFATILLVGACF
GIIYGINVGKDKLNNSSDSISDRTIRFLSILCSFIIVFTNICLRTVIRAFTQTEKHETYT
AYNLSVAFKLTFARFINTSIVPIVVNVATSRWFVDGGLVSDIFYIMISISFLDPILYALD
PFYAIRLFKRFRARRQGKDSIMNQEEANLLWEGPPLDMANRYSNTANLFLTAIFFHPLLP
ISIPIAMVGFIFSYWIDKSLLLRRHKIPEQMSGLMAKFIANLLPYFAFLWSLNLLLFYRT
LYKEYYEDDPRQKLIVPYAIIGLTSFFIILPVRTIINRCLADNTEDALTYKYDDFMLQFP
TDYDRENPVTKNEAFIKLLEHRIQKEKNSVEQDKLLLQKNQLTNASVFDAVRAYSNKREA
MKQQMQQHSLPGFSQGQPQAQQGNLGQAMMRAYNFNTAQVQINQDPTQALRQGVSQYYQQ
YSQGQVYNGAYGGGAYDYYSQPQQYDPYGYYNNYNASNAYGQNYNPAIAAPASVYDNVYD
PYARAAGATASSNYNNQYPASQSSHPRTTVKVKEDLHKEKNPKNLKKKKDNSSDSDKKKK
HHGKKHQQNVKVNDSQLAINQSAVRTSQEQQNNSYTAQNTNNQYPNLNGNPVAYDQYSQA
TGGVGGYGNNNYSQQATYDYNQNVPAAQQQQYNDAAYQQQQQYTAAQQQQYTAAQQQQYA
AQGYGQQYNAQYQQQQYPNQGYY