Identifiers and Description

Gene Model Identifier

Contig20797.0.g56

Standard Name

None

Aliases

Contig20797_0_g56

Description

Ankyrin repeats (3 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005026006.002964263484389e-144WGR domain containing protein
SGDYGR232W0.000000000006001570085597868NAS6 SGDID:S000003464, Chr VII
from 953960-954646, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20797.0.g56(coding)
ATGAGAAGTACCCGCAACAATTAGAGGAGCATGAGCTCTTAAAAACAGACAACCAAGTCT
GTAAGCAGGAAAAAGAAGGACGAAACCTCATCAGATGAAGAGGAAGTTAGTCAAGTTTAG
GCAAATGTGAGATCATCCTCGTCTTCCAAGATACAGCAGAAACCGGCCAGAAACAACACC
AGAAGCTCAAACAAGACTTAACTGAACCAGACATAGTCACAAACTATATATAACAAGGGG
ACCTATGTGGCCTTCGTAGATCCATCTGACTTGAACACATTCAAAATTGGTTAATTGCTG
AATGACTTTATGGAGGAAGACGACGAAACACTTATAGATATCTACCAGGAAACCGCAGCT
AACTCACTAACATACACCAAGCAAGCCAGCAGACAACCAGTGCCCGAATACACCCTCATC
TGCGACGTCCTCGTGACAAAGATTGATGTCAAGAAAGGCGCCAAAGCGCAAATCAAAATC
AACAAGCAGCAGTAAAATAAAGCCAATAGAAACATGCAAAGCGTTGTTCAAAGAATAGAG
TAAGAAGCCAACGAAGAAGAAGACGATGACGAAGATGATGAAGACGACGAAGAGGAAGAA
GAAGAGGAAGAAGACGATCTTGAAGAGAAATCAGAGATCCTCCTCACAAAAGACGATGAG
AAGACCATCAAGGGAAGACGTATAGTAAGCAGAAACGGCAAAATGCCAGCTGCCACTCAA
CCAGTTGTTATGAACAAAGCCAAGAAAGCAGCAGCTGTAAGCAACAAAAGTAATGCCAAA
GCTAAGGGACCTGCCACCAAGAAAGTCACTGATACAGCCACTAAAGCAGCAGGCAAGGGA
AGTAAGAGCAGATCACCAAGCAAGACTAGAGCTGGTAAGAAAGCTGATGAGGATATGGAT
GAAGAGGATCAAGCAGATGATGAGTAAGAAGAAGAAAGCGCTGTTATGATTGACACCTCA
ACAAAGGCATAAGCTCAACAGAGAAAAGGCAGAAAATCAGAAGTTTTACCTAAAGTAGGC
CAGAAAAGACTTAGAACTGCAAAGAAAACCCTCAATGAAGATGAAGAGCGTGAAGAAGCC
GATGATGATGAGGAGGGTGGTTCAGACCATTCCAACAGCAAGCCTGGCAAGAAAAGAAAG
ATCGCACCTGGTAAAGAGAAGGTAGTGAAGGAGAAAGTAAAGAAAGCGCCAAAGAGACCA
ACTGAATTTAAGAAAGGTAGATGGAACCCAGATATCGAAATTGTTGATACTGATAAATAT
AAAGACGAAAATTCTAATGACTTGCACATGGACTGTTGTATTAGATGCAATAATAAGAAT
ATTATAAGAGCTTGTTTAACTGAGAATGAAAAATTGCTTAAGAAAGGAATTGAACAAACC
AAAAAGATATCAAACCTCGTCGCTTACTGGAGTCCAGAGTGCAAATGGACATCACTTGAG
TATATGGTTTCTAAAAATCTTCACAACTTCCTTGAAATTATGATGCACCCTAAAATTGGA
AAAATTCCAGCTCATAGTACTTACGAAAAGGAAAGGGATCTTATATTCGCATAACGTGTT
CGTGATCCACAGTATCTCATGAATGTAGTTGATTCAGGGACTGTTAGTCACATGGCTTAT
GGAGCAAGAGTTAGAAAAGTTCAAATGACAAGAGGTAACAGGCAAGGAAACAATGCTTTC
CTCGAATATGTAGACAATGAACTAAAGATTCCAAATTACTACATCCAAAGTGAGAATTTC
ATTAGGAGAATGCTCTACTCAGAGAGCGTAGATTATGAAACTTTTAAGCAAATTTATAAG
CTTAACTCAAATATCGAAAGTTATCTCTAAAACTATGCTTATGAAGCAGTTAGAGCAGGT
AATAGAAAGATTGCCTATGAACTTATTTCAAAGATGGCCAAGTATCCAAACTTCGGCTTC
AATTAATTGCATGTTGATGCTTTGAGTGATGATGCAAACTTTGACAAAATTCTTAAAGTA
TCTGTTGGAAAGAAAGCCAACACAAATAAAGACATAACACCTTTGTTCTGTGCATGCATT
AATGCCAATCCAAAATTCATTAGAGCTTTCTTAGATGTTGGCCCAGATAGTGCTATGGTA
GATTATGATCTCAGAAGAGCTGCTCATTATGCCGCTGCTTGCGAAGGTCCAGAACCTCTA
TAAGAACTCATTAAAGCAGGATTTTCAATTACTGATGTTGATAATTAGAAAAGAAATTGT
CTTCATATTGCTGCAATGACTGGCAGAGCACATAACGCAAGATTAATTTTGTAAACTGCT
CCTTAATTATTGAATGCAAGAGACAAAAAGAGCAGTAATGCAATGGCATATGCTTGCAAG
TATGGCAAGACTGAAGTTGTCAAAGTTCTTCTTGAGTTCAAAGCAAAAGTAAATATGGGA
TGCGGTATTTAAAGAATGACTCCCCTTTGCTGGGCATCAGCCTATGGTCACTTAGATCTT
GTTAATTATTTGCTAGACAATAAAGGTAGAACTCTTAGCAAAGATAAGTTCAAGAGAACT
CCTTTAATAATGGCAGTAAGAAATGGTCACACTAAGATTGCTTCAATTCTACTATAAAGA
GGCTCTGAATGGTATCACTCTGATTCATCAATGAATTAACCTCTTCATTATGCTGCCGCA
TACGGATGGATTGATTGTATTAATCTCCTTATTAAAGCTGGTGCAGATGTTAATGCCTAA
AACTCATGGAAAATTTCTCCAATCAATATTGCAATGCTCAAGAATCATCACGGATGTGTA
AAAAGATTACTTGAAGAGCCAAATGTAAACGTCAATGGAAAAGACGATAAGGGCAGAACT
TTGATTATGTTGTCACTTTTTGCTCTAGATGAGGAAACTGAGGAATTTGTTTCTTATTTA
CTCAAGAAAGGGGCTGATCCAAACATTGCAGATCTTGAAGGAATGACCTCACTTCATTAT
ATTGCCAAGTATGTTCCTAAAGGAGTTGATCCAATGACTGGACAGCATAACAGAGCTGAG
TATCTAAAGCAAGTTGAAATCCAAAAGAAAGTAACTCAGTTATTGATTCAATATGGTGCC
GATTTAGCTTAAAAGGACAATCAGAAAAGAACTGCTTTCTCAATTTGCTTAGACTCTGAC
AATGCCCCACTTCTTGAATTCCTTAAAGATAAAGTTTCAATTAACAAAGAACCAGAACTT
CTCTTTGCTTTTAAGGATAAGATATTCAACATAGCCTATCAAAAGATTCTTGAAAGACTA
ATCTTAAATGATCCACCAACCAAAGAAACCATTAACTTCTTGGACGAGGAAGGTTTTACA
CCATTTTTAAAGTACATCAAATCTTTTACTGATAGCTACACCAACTTCTTTACTCTCATT
TAGAATAGAGTTAATCAATAGTCTTTCCTCTATGGAAATGACTTCGGCAAATACAGAATC
ACAAATGAAGACTTATTCGATAAGTTTGCTGATCAAACAAACTATTATAACTACAACTAC
AATTTCACTCAAGAGTAAAAGAATGAGTTAAGCAGAAAATTCATCGATGAAATAATAGTA
CAGCCATTCATTAAGATCCTTTAATTCATGATTAGTCAAGGTGCAGATGAACATTATATT
GTGATGAAATTGAAGAAGTATAGAGACATCGAGCTTCAGAAGAGCAATATGATCGCAAAC
TTAAATGCGCAAGGTCAAGATGCTAAAATGAAGACTGAGGAGGAAGAGAAAGTCTTAAGA
AGAGAAGAGAAACTTGGGAAAATGAGGCAGGGTCGAGTAAAATCAGCTAAAAGATCTGCT
TATGTTCCATTTGGACAACCTAGTGCATGGGGAGGTAGCATTAAATTGGATTAAGCATAG
AATGAAAACGATGGAACAGATAAGTACGAGGTTATTGGTGGCCAGAAAGTGTTGAGAGAA
TATGGATCTTTAGGTAAGAGAAACGCAATTCACTTGCTGATTTCCAAACCATAAGAAAGG
CTATTTGACTTCTTGCTCTCACTGAAAATTAACCCTGATTAACCAGATTATGACGAAGTA
ACTCCCTTTAACTAATTAAGCAAGGACAACCTCGTAAAAAGTGGAGAGCATATGTACTAA
AATGCATTTGATAAATTCTTGGACATAGAAGTTAGAGTTGACTATCCTGATGTTAAAGGT
AGAACTCCATTCCTAAACTACTATGATAGCTAAATCTTTGAAATCGCTTACAGAATGTTA
GCCTTAGGTGCAAATGTTAACTAAATGGACAATAGTGGATTGTTTGCTTTGAAATATGCT
TTAATCAGAAGATAAAACTAAAAAATTCAAGAGCTTTTGGATCACGGTGCTAACATAAAT
CAAATTGACAATAAGGGAAGAAACTTGCTTCATCATGCCATCAATATGTCCAGTGCAACT
GCTGATGCCACTTTTGAAACTGAGCTTTTCCTAATAGAAAATGGAGTAGATATAAATTTA
AGAGATGTGAACAACCGTACACCACTTCATTATGCCTTTGTTAAGATAGATAATTGGAAT
GATGCAACACAGATTGATCCTATTGAAACTGTCAGCTCACTTTGTGGCATCAAAGGCTTG
GAAATTGATGTCCAAGATAAATGGCAGAAGACTCCATTGCATTATGCTTCACAGAGAGGA
GCATCAATATGCGCATTGTATCTAATTGAAAGAAATGCAAATAAGGAAAGCATTGATATT
TATGGTAACACACCCTTAGGAGTTGGTTTAATGCGTAGACATTATAACTATGGCATTATC
TTGATCCAGAAGGAAGTATCTGTAAAACGTTTGGCTTACAGAGAAGACTATGAGAGAATC
AAGAAGATGTGGGAAGAAGAGGAGAAAAAGTAAAAATTACTTGACTCAAAGAAGAAAGCA
AGCATAGATATAGAGATGGAAGATGAATCTACAAAGAAGGACAAAAAGAAGAAGCATAGA
AATATGTTCAACGGTGGTGCCATGAATAATGATTATGGAGATGAATATGACGAAGAGTAT
GATGAAGAGGAGGAGGATGAGGAGTATTAATAATAAGCCTATCAAGAGAGTGTTTTTAAC
AACTAAAACGCTTTTGGGATGCCAGTTTATAGACAAAAAGTGTTAGCAAGAAAGGCTATG
CCTTTCAATAATGGATTTGGCTTTGGAGGTGGAATGTTCGGAGGAGCACTTGCCCAGCCA
GCTTAACCTGCTCAACAAATGAACGCATACTCAACTGGAGATTTGATTGCTGAAAATGAT
CATGAAGGAGTTTCTATGTTTAAGTTAGCCATCAGAGGAGGACAACAAGGTCTTGCTTAT
CTCATGCTTGATAAAGGCTATGATTTAATGCACGCTATGCAAGATGCTATGGATGAGAAA
AAGTTCATGCTTGTACTAACACTTCTCTCCAAGACCCCAGAAGATGAGGTAGTTTAACAA
AAGAACAAGAAAAACCAAAATCTTTTCCACATTTTATCGATGAATGCTTCAAGCTGTGCC
TTTGAAACTTTAAAGAGGATTTATGATGCTTTGAGGAAACGTGGAGTTGATGTCAGAGCA
AAAGATAACTTCGGCAGAAACGCACTACATTATGCAGTCATAAGTGGTTCTCTACAGCTA
GTTCAATTATTACTTGGTGAACAGCCTCCATACGATCCAAATGAAGTTGATAATGAAGGC
TTTACTCCACTTGCTCACTTTGTAAAAGGTAAAAGATTAGAGAGTTCTGTTTATAACCCA
GATATAATGATGCCTAATATTTTCTTGAGCTTGGTTAAAGCTGGAGCTGATGTTAATGTG
GTTTATCCTGAGGATAATTTCAAGCCAGCTTTTAAGGAAGATGAAGTTAATGGCCATCTA
TACGATCCTAAAGGAAAATACTATAGCACACCTCTGATTACTTTAATTAGATTAGGTCCT
AACAATAATCTTCTAAGAGCCAACATGATTGGATTGATCGAGTATGGAGCAAAATTAGAT
GTCCTAGATAGTGATGGTAGAGATCCAATAATGCATGCCATTAAAAAGAACAACGCAATG
GTAGTTACCATTTTACTTGAAAACAAGAGAGCTTTGAAGTATAACCCAGAAGGCCAAGAT
TTAGCTGGAAAGTCAGCTGTTCATTATGTAATTAATCCTTTGCCTTATGGTTCATATGAA
AATGTTGAAATCCTTAAACTCTTGCACAAGAACAAATTCAATATGACACTCAAGGATGCA
CAAGGTCGCACTCCTGCTTCATATGCCTCAGAGTAAGAAAGTGGTGTATTGTTGAAAGAA
TTGGCTAAGCTTGTTGGTTAATAAGAATAACTTAATGGTTTCAGAAGAGCAATTTCTGCT
ATTGATACAGGTAAATGGCCTGAACAAAAAGTTGACTTTGAACTAGATGCAGAATAATAT
ATGGATGAAGCTTAAGAAAGAGAAAAGAAGCTAGCCAAAGAAAAAGAATTCAGAGTTCCA
GTTGATAAAACAGGCCACTTTGAAATATCATATGAAGTATATTATGACGGAGAAGATAAG
CCTTGGGATATTTATATGACTAAAGTAGACTTAAAGAATGGTATTTATGGAGATTATGTC
TTCTACAAAATGCAACTTCTTCATGATAAGAACAGAGACCTATATGTAGTATTCACAAGA
TGGGGCCGTATTGGGGAAACTGGTATGAATCAAAGAACTCCCTTCAATAACATCGATGAA
GCTAAATAAGATTTCATGAAGATCTTCAAGCAAAAGACTGGAAATAACTTTGAAGAACTT
GACCAATTTTCTAGAGTTAAGAAGAAGTACAATATTGCAAGAGTCAACTACATCACAGTA
AACTACAAAGATTACTTGCAACCATTTGACTATGATAAATGCCCTAGATCTAAATTAACA
AAAGAGATATACGACTTGTTTGAAGAAGTGTCTAACGTCACTATGTATCAAAGAGCCATG
AACTAATTCGGACTTGACTCAGAAGCACTACCCTTCAGTGGTGTTAAGAAAGAGTCTCTA
ATTGAAGCTAGATAAGTTCTTATGGAGATTCAAGAACTACTTAATGAAGACCAGCAATTA
TCTAAGGAGGGAATTAATGCTGATTATGATAAATTGGCTGCTTGTAAGGAAAAGGTTTGT
GAACTTTCATCAAGATATTACGAACTAATTCCTCTTGCAGCATATAAAAATCAAATTGCT
CCTCCCCTTAACTACGCTCATTTGATTAAGAATTAATATGACATGCTTGAAAGTCTGACA
AATATTGAATTTGCCTCAAAGATGCTTCTCGCAGCTCTTCTCAGATAACAAGAAATGAAC
CCAGTTGATTATGTTTATCAAGCATTGAACTTAATGATTGAGCCACTCGAAAAGCAAAGT
GGCGAATTTGAAGTTATCAATTAATATATTGAACAAACAAGAAACTAAGACGGCTACAAC
AATATGCAAAACTTTGAGATATCAAACATCTTTAAAATGCAAAGAAAAGGTGAAGCCGAA
TGTATATAAGCCTACAAAGATGTTCCAAATCACTTCCTACTGTTCCACGGTTCTTAAATG
TTCAACTTCCTCGGTATCTTAAATCAAGGTTTAAGAATAGCTCCTCCTGAAGCACCAGCC
ACTGGTTACATGTTCGGTAAGGGTGTCTATTTTGCAGATATGTTCGACAAAAGTTTCGCT
TATGCAGCTAGAGGATATTAACAACAAGATAGCTATTTGATGCTAATGTGCGAAGTTGCT
TTAGGCAAGTCAAAGGAACTCTACACAGCAGAGTATGTTGAGAAACTTGATCACCCCTAC
AGCAGTGTTAAGGGTATGGGACGCAGAGGGCCAGGTTACAAAAATACTGTTGTATGTCCA
AACGGTGTCAAGATTCCTCTTGGGCCAGTCATCAACTATCACGAAGATAAGCCACACTTG
CAGAAATAGCTATAGCTTCAACATAACGAGTACATCGTCTACAATACCTCATAGATTAGA
ATGAGATATATAGTTTAGATTTCAAAGAAGAAACCACAACCAGCAAAATGA


>Contig20797.0.g56(protein)
MRSTRNNQRSMSSQKQTTKSVSRKKKDETSSDEEEVSQVQANVRSSSSSKIQQKPARNNT
RSSNKTQLNQTQSQTIYNKGTYVAFVDPSDLNTFKIGQLLNDFMEEDDETLIDIYQETAA
NSLTYTKQASRQPVPEYTLICDVLVTKIDVKKGAKAQIKINKQQQNKANRNMQSVVQRIE
QEANEEEDDDEDDEDDEEEEEEEEDDLEEKSEILLTKDDEKTIKGRRIVSRNGKMPAATQ
PVVMNKAKKAAAVSNKSNAKAKGPATKKVTDTATKAAGKGSKSRSPSKTRAGKKADEDMD
EEDQADDEQEEESAVMIDTSTKAQAQQRKGRKSEVLPKVGQKRLRTAKKTLNEDEEREEA
DDDEEGGSDHSNSKPGKKRKIAPGKEKVVKEKVKKAPKRPTEFKKGRWNPDIEIVDTDKY
KDENSNDLHMDCCIRCNNKNIIRACLTENEKLLKKGIEQTKKISNLVAYWSPECKWTSLE
YMVSKNLHNFLEIMMHPKIGKIPAHSTYEKERDLIFAQRVRDPQYLMNVVDSGTVSHMAY
GARVRKVQMTRGNRQGNNAFLEYVDNELKIPNYYIQSENFIRRMLYSESVDYETFKQIYK
LNSNIESYLQNYAYEAVRAGNRKIAYELISKMAKYPNFGFNQLHVDALSDDANFDKILKV
SVGKKANTNKDITPLFCACINANPKFIRAFLDVGPDSAMVDYDLRRAAHYAAACEGPEPL
QELIKAGFSITDVDNQKRNCLHIAAMTGRAHNARLILQTAPQLLNARDKKSSNAMAYACK
YGKTEVVKVLLEFKAKVNMGCGIQRMTPLCWASAYGHLDLVNYLLDNKGRTLSKDKFKRT
PLIMAVRNGHTKIASILLQRGSEWYHSDSSMNQPLHYAAAYGWIDCINLLIKAGADVNAQ
NSWKISPINIAMLKNHHGCVKRLLEEPNVNVNGKDDKGRTLIMLSLFALDEETEEFVSYL
LKKGADPNIADLEGMTSLHYIAKYVPKGVDPMTGQHNRAEYLKQVEIQKKVTQLLIQYGA
DLAQKDNQKRTAFSICLDSDNAPLLEFLKDKVSINKEPELLFAFKDKIFNIAYQKILERL
ILNDPPTKETINFLDEEGFTPFLKYIKSFTDSYTNFFTLIQNRVNQQSFLYGNDFGKYRI
TNEDLFDKFADQTNYYNYNYNFTQEQKNELSRKFIDEIIVQPFIKILQFMISQGADEHYI
VMKLKKYRDIELQKSNMIANLNAQGQDAKMKTEEEEKVLRREEKLGKMRQGRVKSAKRSA
YVPFGQPSAWGGSIKLDQAQNENDGTDKYEVIGGQKVLREYGSLGKRNAIHLLISKPQER
LFDFLLSLKINPDQPDYDEVTPFNQLSKDNLVKSGEHMYQNAFDKFLDIEVRVDYPDVKG
RTPFLNYYDSQIFEIAYRMLALGANVNQMDNSGLFALKYALIRRQNQKIQELLDHGANIN
QIDNKGRNLLHHAINMSSATADATFETELFLIENGVDINLRDVNNRTPLHYAFVKIDNWN
DATQIDPIETVSSLCGIKGLEIDVQDKWQKTPLHYASQRGASICALYLIERNANKESIDI
YGNTPLGVGLMRRHYNYGIILIQKEVSVKRLAYREDYERIKKMWEEEEKKQKLLDSKKKA
SIDIEMEDESTKKDKKKKHRNMFNGGAMNNDYGDEYDEEYDEEEEDEEYQQQAYQESVFN
NQNAFGMPVYRQKVLARKAMPFNNGFGFGGGMFGGALAQPAQPAQQMNAYSTGDLIAEND
HEGVSMFKLAIRGGQQGLAYLMLDKGYDLMHAMQDAMDEKKFMLVLTLLSKTPEDEVVQQ
KNKKNQNLFHILSMNASSCAFETLKRIYDALRKRGVDVRAKDNFGRNALHYAVISGSLQL
VQLLLGEQPPYDPNEVDNEGFTPLAHFVKGKRLESSVYNPDIMMPNIFLSLVKAGADVNV
VYPEDNFKPAFKEDEVNGHLYDPKGKYYSTPLITLIRLGPNNNLLRANMIGLIEYGAKLD
VLDSDGRDPIMHAIKKNNAMVVTILLENKRALKYNPEGQDLAGKSAVHYVINPLPYGSYE
NVEILKLLHKNKFNMTLKDAQGRTPASYASEQESGVLLKELAKLVGQQEQLNGFRRAISA
IDTGKWPEQKVDFELDAEQYMDEAQEREKKLAKEKEFRVPVDKTGHFEISYEVYYDGEDK
PWDIYMTKVDLKNGIYGDYVFYKMQLLHDKNRDLYVVFTRWGRIGETGMNQRTPFNNIDE
AKQDFMKIFKQKTGNNFEELDQFSRVKKKYNIARVNYITVNYKDYLQPFDYDKCPRSKLT
KEIYDLFEEVSNVTMYQRAMNQFGLDSEALPFSGVKKESLIEARQVLMEIQELLNEDQQL
SKEGINADYDKLAACKEKVCELSSRYYELIPLAAYKNQIAPPLNYAHLIKNQYDMLESLT
NIEFASKMLLAALLRQQEMNPVDYVYQALNLMIEPLEKQSGEFEVINQYIEQTRNQDGYN
NMQNFEISNIFKMQRKGEAECIQAYKDVPNHFLLFHGSQMFNFLGILNQGLRIAPPEAPA
TGYMFGKGVYFADMFDKSFAYAARGYQQQDSYLMLMCEVALGKSKELYTAEYVEKLDHPY
SSVKGMGRRGPGYKNTVVCPNGVKIPLGPVINYHEDKPHLQKQLQLQHNEYIVYNTSQIR
MRYIVQISKKKPQPAK